KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW007494Help
Entry
IscW_ISCW007494   CDS       T01131                                 

Definition
hypothetical protein
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
isc  Ixodes scapularis (black-legged tick)
Brite
Enzymes [BR:isc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     IscW_ISCW007494
Transfer RNA biogenesis [BR:isc03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    IscW_ISCW007494
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 553 aa AA seqDB search
KTRRFLSGLSKEEVQMRVISEIIKELLVAQKEKRDVNLNSIKGSISSKYGLHSQPKIVDI
IAAIPAQYKKVLLPKLKAKPVRTASGIAVVAVMCKPHRCPHINMTGNICVYCPGGPDSDF
EYSTQSYTGYEPTSMRAIRARYDPFLQTRHRIQQLRQLGHSVDKVEFIVMGGTFMSLPED
YRDWFVRSLHDALSGHTSGSVGEAVLYGERARTKCVGITIETRPDYCLKRHLGDMLLYGC
TRLEIGVQSVHEDVARDTNRGHTVRAVCESFRLAKDAGFKVVAHMMPNLPNVDFERDIDQ
FVELFENPAFRMDGLKVYPTLVIRGTGLYELWKTGRYRSYPPGFLVDLIAKILALVPPWT
RIYRVQRDIPMPLVTSGVEHGNLRELALARMRDFGTRCRDVRTREVGIQEIHHRVRPNQV
ELIRRDYVANGGWETFLSYEDPEQDILVGLLRLRRCSEETFRPELKGGASMVRELHVYGS
VVPVSVRDPTKFQHQGFGTLLMEEAERIALTEHGSSKIAVISGVGTRNYYRKLGYELDGP
YMSKQLPTDLVRG
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
aaaacccggaggttcctttcaggtctgagcaaagaggaggttcaaatgagggtgatctcg
gagattatcaaggagcttctcgtagcgcaaaaggagaaacgagatgtgaatctcaacagc
atcaagggttcaatctcctccaagtatggacttcattctcaacccaagatcgtcgacatc
atcgctgccataccggcccagtacaagaaggtccttctcccgaagctcaaggcaaagccc
gtgcgaactgcaagcggaattgcggtggttgcggtcatgtgcaagcctcatcgatgccca
cacatcaacatgaccggaaacatctgcgtgtattgcccgggcggaccagactctgatttt
gagtactctacccagtcgtacaccggctatgagccgacgtctatgcgggccatcagggca
cgctacgacccgttcctccagacacgccatcgcatccagcagctgcgtcagctaggccac
tcggtggacaaggtggagttcattgtgatgggcggcaccttcatgtcccttcccgaagac
taccgggactggtttgtgcgctctctacacgacgccctctcggggcacaccagcggctcg
gtgggcgaggccgtgctgtatggcgagcgggcgcgcaccaagtgcgtcggcatcaccatc
gagacccggccggactactgcctcaagcggcacctgggggacatgctcctgtatggctgc
acgcgtcttgagatcggagtccagagcgtccacgaagacgtggcgagggacaccaacagg
ggccacacggtgcgtgcggtgtgcgagtccttccggctggccaaggacgcaggcttcaag
gtggtggcacacatgatgcccaacctgcccaacgtggacttcgagcgggatatcgaccag
ttcgtggaactgtttgagaacccggccttccgcatggacggccttaaggtgtatcctacc
ctggtaatccgagggaccggcctgtacgagctgtggaagaccggccgctaccggagctac
ccgccgggtttcctggtggacctcatcgccaagatcctcgccctggttccgccctggacg
cgcatctacagggtccagcgggacatccccatgcccctggtgacctctggcgtggagcac
gggaacctgcgggagctggccctggcacgcatgcgggacttcggcacaaggtgtcgcgac
gtgcgcacccgcgaggtcggcatccaggagatccaccaccgggtgcggcccaaccaggtg
gagctgatccggcgggactatgtggccaacggtggctgggagacgttcctttcgtacgag
gaccccgagcaggacatcctggtggggctgctgcggctgcgcaggtgctccgaggagacc
ttccggccagagctgaagggcggggcgtcgatggtccgggagctccacgtgtatggaagc
gtggttccggtcagtgttcgtgaccccaccaagtttcaacatcagggctttggaacgctg
ctgatggaagaggccgagaggatagccctgactgagcatggctccagcaagatcgccgtc
atctcaggtgtgggcacacggaactactaccgcaagttgggctacgaactggacgggccc
tacatgtcgaagcagcttcccacggaccttgtgaggggataa

  All links  
No link information was found.   
DBGET integrated database retrieval system