KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW007522Help
Entry
IscW_ISCW007522   CDS       T01131                                 

Definition
hexosaminidase domain-containing protein, putative (EC:3.2.1.52)
Orthology
K14459  
hexosaminidase [EC:3.2.1.52]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
Other glycan degradation
Brite
KEGG Orthology (KO) [BR:isc00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    IscW_ISCW007522
Enzymes [BR:isc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     IscW_ISCW007522
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 589 aa AA seqDB search
MGVPAVSSAMFATGKLCVHQIVLAMWRRKPILLFGVLLVVILVVLLQYSSLGTTNVRPET
LLASPIGMAAPVPAELQWAGQQQRPAPEPKPQLPAGAHSKAYVPELRFVHLDLKGAPPKV
AYMKQLFPLLREAGANGLLLEYEDMFPYHGSLEPIRAKNAYTKAEIGEILAAAKENSLEV
IPLVQTFGHLEFVLKLPEFRHVREIDEHPTALCPSRNESFVVVSTIVDQVLELHPKAKWL
HIGCDEVFHMGYCSRCSHRDREDLFLSHVQRVARHVRERHGRLPIIWDDMLRQISAEKLK
PLGKLVEPMVWSYVKDVYRFISYNNWGTYSEAFESIWAASAFKGAFGETLTVPNARMHLE
NNEGWLEVMSEQHAKFPRFRGIVITGWQRYDHFATLCELLPAGLPSLILNLLVLTNGAYS
SDLQGRYHSLLKCTHSRSPMDLQSDPFLWQKGYGCFFPGSAVFRLTQTHSETVKKAQDYI
HDVTIGKAWVTDYNVRRNLTLPSRVDQVLEDHSSTLYSLTSLVHQARDVLREVFDEYTVA
EWIEQNIYPLVLRLERLWNEALAIKKPRVWPVRPLEPLADLRRFNIGGV
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgggggtccctgcagtgagcagtgcaatgtttgccactggaaagctctgcgtgcatcag
attgttttggccatgtggcgcaggaagccgatcctgctttttggagtgcttctggtggtc
atccttgtggtgttgctccagtatagctcgctgggcaccaccaacgtccgcccggagact
ctgcttgcctctcccatcggtatggctgctcctgttcctgcggagctgcagtgggctggc
cagcagcagaggcctgctcctgaaccaaagccccagctcccggctggggcccattccaag
gcatatgtgcccgagctacgctttgttcaccttgacctcaagggcgcaccaccgaaggtg
gcctacatgaagcaactgtttccactgctccgggaagctggtgccaacgggcttctgctg
gagtatgaggacatgttcccttaccacggctcactggagccaatccgcgccaagaatgct
tacaccaaggcagagattggcgagattctggctgcagccaaggagaacagcttggaagtg
ataccactggtacagacttttggacacctggagtttgtgctcaagctgcccgagtttagg
catgtgcgcgagatagacgagcacccgacagccctgtgcccttcgcgcaacgagagcttt
gtggttgtgagcaccattgtggatcaggtgctggaactgcatcccaaggctaagtggctg
cacattggttgtgatgaggtgttccatatgggctattgctcacgttgcagccatcgggac
agggaggacctgtttctaagccacgtgcagcgggtggcacggcatgtgcgggagcggcac
ggccgtctgcctatcatctgggacgacatgctgcgccaaatcagtgccgagaaactaaag
cccctgggcaagttggtcgagcccatggtgtggtcgtacgtgaaggacgtctaccgcttc
attagctacaacaactggggcacatacagcgaagcattcgagtccatttgggcagccagc
gcatttaagggtgcctttggagagaccctgacagtgcctaatgcccgcatgcacctggag
aacaatgaagggtggctagaggtcatgtctgagcagcatgccaagttccctcgcttccga
ggcatagtgataactggctggcaacgctacgaccactttgccacactgtgcgagctgctg
cctgctggtttgccttcgctcatcctcaacctactggtgctaaccaacggggcttacagc
agcgatctccagggaaggtatcacagccttctaaagtgcacccactcgcgttctcctatg
gaccttcagagcgacccctttctctggcagaagggatacggatgtttctttccgggctct
gccgtgtttcggctcacccagacgcacagtgagacagtgaagaaggcccaagactacatc
cacgatgtgacgatcggcaaggcttgggtcaccgactacaacgtgcgtcgcaacctgacg
ctacccagcagagtggaccaagtcctggaagaccactcgtcgacactgtacagccttaca
tcactggtgcaccaggcacgcgatgtgctacgcgaagtctttgacgagtacaccgtggcc
gagtggatcgagcagaacatctatccgttggtgctgcgcctagagaggctctggaacgag
gcactggcgatcaagaagcctcgcgtgtggcccgtgcggccgctcgaacccctagccgac
ctacgccgcttcaacattgggggcgtgtga

DBGET integrated database retrieval system