KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW007830Help
Entry
IscW_ISCW007830   CDS       T01131                                 

Definition
histone deacetylase 1, 2,3, putative
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:isc00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    IscW_ISCW007830
Enzymes [BR:isc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     IscW_ISCW007830
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 484 aa AA seqDB search
MELLLTRGDIGNYYYGQGHPMKPHRMRMTHNLILNYGLYRKMEIYRPHKATQEEMTKYHS
DDYIRFLRSIRPDNMSEYNKQMQRFNVGEDCPVFDGLYEFCQLSTGGSVVWKRLLGVAEL
MMRACAWDRYHQRVLYIDVDIHHGDGVEEAFYTTDRVMTCSFHKYGEYFPGTGDLRDIGA
GKGKYYAVNFPLRDGIDDESYESIFQPLISKVMEMYQPSAVVLQCGADSLSGDRLGCFNL
TLKGHGKCAEFVRKYNLPLLQLGGGGYTIRNVARCWTYETAVALGVDIANELPYNDYFEY
FGPDFKLHISPSNMANQNTPEYLEKIRTRLFENLRMLPHAPGVQMQPIPEDAMDQESEDE
DKVNSDERISIRASEKRVACDEEFSDSEDEGEGGRRDNRSHRPKKHRKGTSITAGAGGGG
GAPAGGNAPQAAPTQSPAEEELKAAPPGDAKATAPAEGQPAKKDVDDKDDKKMDTSTTEK
DGKA
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggagctgcttcttacccgaggggacatagggaactactactacgggcagggccacccc
atgaagccccatcgcatgcgcatgacccacaacctgattctcaactatgggctgtaccgg
aagatggagatctacagaccgcacaaggcgacccaggaagagatgaccaagtaccacagc
gacgactacattcgcttcctgcgcagcatccggccggacaacatgtcggagtacaacaaa
cagatgcagagattcaacgtcggcgaggactgccccgtcttcgacggcctttacgagttc
tgtcagctgtccaccggcgggtccgtggtgtggaagcggctgcttggggtggcagagcta
atgatgcgtgcgtgcgcgtgggacaggtaccaccagcgggtgctgtacatcgacgtagac
atccaccatggcgacggggtggaggaggccttctacacgacggaccgcgtcatgacctgc
tccttccacaagtacggcgagtacttccccggcacgggagacctcagggacattggtgct
ggcaaaggaaaatattacgccgtcaacttcccactgcgagacggtatcgatgacgaatcg
tacgagagcatcttccagccgctcatctcgaaggtgatggagatgtaccagccgagcgcg
gtggtgctccagtgcggggcggactcactgtccggggaccgcctgggctgcttcaacctg
accctgaagggccatggcaagtgcgccgagtttgtgcgcaagtacaacctgcccctcctg
cagctgggcggagggggctacaccatccgtaacgtggcacgctgctggacctacgagacg
gccgtggcgctcggcgtggacatcgccaacgagctgccgtacaacgactactttgagtac
tttgggccagacttcaagctgcacatcagcccgtccaacatggccaaccagaacacacca
gagtacctcgagaagatcagaactcggcttttcgagaatctcagaatgcttccacatgct
cctggagtccagatgcaaccgattccggaggacgcgatggaccaggagagcgaggacgag
gacaaggtgaactcggacgagcgcatcagcatccgggcctcggagaagcgggtggcgtgc
gacgaagagttctccgactcggaggacgagggggagggaggcagacgggacaaccggtcg
caccggcctaagaagcaccgcaagggcacctccatcacggccggagcgggcggagggggc
ggggcccccgccggagggaatgcaccccaggcggcacccacccagtcgccggctgaggag
gagctcaaggcggcgccgcccggggacgccaaggcgacggcgcccgccgagggacagccc
gccaagaaggacgtcgacgacaaggatgacaaaaagatggacacgtccacaacagagaaa
gacggcaaagcctga

  All links  
No link information was found.   
DBGET integrated database retrieval system