KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW007896Help
Entry
IscW_ISCW007896   CDS       T01131                                 

Definition
cAMP-dependent protein kinase catalytic subunit, putative (EC:2.7.11.12)
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
isc  Ixodes scapularis (black-legged tick)
Brite
Enzymes [BR:isc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     IscW_ISCW007896
Protein kinases [BR:isc01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   IscW_ISCW007896
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 592 aa AA seqDB search
RRSKQLIKDAIMENDFLKNLDSSQVREVVDCMYPQVFEAGTLVIRERDVGSHLYVSAEGE
LEVEKEDRVLGRMGPGKAFGELAILYNCTRTASVKAVTKAKVWVLDRRVFQAIMMKTGLQ
RQEENIQFLRSVPLLQTLSNEVLAKMSDVLEVDFYPAGVYIIRQGTSGDTFFIISHGSVK
VTKRIEGTNQEEEIRILNRGDYFGEQALLRRVGTEDKRTANVVSLDPGVECLALDRDSFI
QLIGDLRELQDKHYDDRLQLRPPQSKALEVDSEVKPIQLDDLEVLATLGIGGFGRVELVQ
YVQDRSRTFALKCLTKKHIVETQQQEHVLSEKALMMSCRHPFICRMFKTFRDEKYVYMLM
EACLGGEVWSLLRDRGSFDEGTSRFYTGCVLEALQYLHDKGIVYRDLKPENMVLDSVGYA
KLVDFGFSKRVPAGQKTWTFCGTPEYVAPEVVLNKGHDRAVDFWAVGVLMFELLAGTPPF
AADDPMKTYNVILKGIDMLDFPRNMSRNAVSLIKRLCRENPSERLGYQKGGIMDIKKHKW
FQSFDWDGLQARTLQPPFEPQIRGPADSSNFDVYPRNFEIPQDETSGWDEDF
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
cgcaggtcgaagcagctcatcaaggacgccatcatggagaacgacttcctgaagaatctg
gactcatcgcaggtgcgggaggtggtcgactgcatgtacccgcaggtcttcgaggccggc
acgctcgtcatcagggagagggacgtcggctcgcacctctacgtgtccgccgagggtgag
cttgaggtggagaaggaagaccgagtgctgggtcgaatgggtccaggcaaggccttcgga
gagttagccatcctctacaactgcacccgcaccgccagcgtcaaagcggtgacgaaggcc
aaggtgtgggtgctggatcgacgcgtcttccaggcgatcatgatgaaaaccggtctccag
cggcaagaagaaaacatccagttcctcaggagcgtcccgctcctgcagacgctctccaac
gaggtcctggccaaaatgtcggacgtcctcgaggtggatttttatccggcgggggtgtac
atcatcaggcaaggaacgtcaggagacactttcttcataatcagccacggaagtgtgaag
gtcaccaagcggatcgaaggtaccaaccaggaagaagaaattaggatcctcaatcgcgga
gactacttcggagagcaagcactgctcaggcgagtgggcacagaagacaagcggacagcg
aacgtagtctctctggaccccggagtggaatgcctcgctctggacagggattcattcatc
cagctcatcggcgatctacgagaacttcaagacaagcactacgacgaccgactccagcta
agaccaccacagagcaaagcactggaagtggactccgaggtgaagcctatccagctggac
gacctcgaagtgctggccacactgggaatcggaggcttcggacgagtggagctggtgcag
tacgtgcaggaccggagccgcacgttcgctctcaagtgcctgaccaagaagcacatcgtg
gagacgcagcagcaggagcacgtgctgagcgagaaggccctgatgatgtcctgccggcac
ccgttcatctgccgtatgttcaagaccttccgggacgagaagtacgtctacatgctcatg
gaggcctgcctcggaggggaggtctggtcactgctcagggacaggggctctttcgacgag
ggcaccagccggttctacacgggctgcgtgctggaggccctgcagtacctgcacgacaag
ggcatcgtgtaccgggacctcaagcccgagaacatggtactcgactcggtcggatacgcc
aagctggttgatttcggcttctcgaagcgtgtgccggcgggccagaaaacgtggaccttc
tgcggcacccccgaatacgtggctccggaggtcgtgctcaacaagggacacgaccgcgcc
gtcgacttctgggccgtgggcgtgctcatgttcgagctgctggccggcacgccaccgttc
gccgcagacgaccccatgaagacgtacaacgtcattctcaagggcatcgacatgctggac
ttcccgcggaacatgtctcgaaacgccgtgtccctcatcaagaggctctgccgggagaac
ccctcagagcggctgggctaccagaaaggaggcatcatggacatcaagaagcacaagtgg
tttcagagttttgactgggacgggctgcaggcacggacgctccagccacccttcgaacca
cagatacggggtcccgcagacagttccaacttcgacgtctacccacgcaacttcgagatc
cctcaggatgagacgtcgggatgggacgaagacttctga

DBGET integrated database retrieval system