KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW007923Help
Entry
IscW_ISCW007923   CDS       T01131                                 

Definition
histone deacetylase complex, catalytic component HDA1, putative
Orthology
K11405  
histone deacetylase 8 [EC:3.5.1.98]
Organism
isc  Ixodes scapularis (black-legged tick)
Brite
Enzymes [BR:isc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     IscW_ISCW007923
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 413 aa AA seqDB search
MYDQWYYTTFEEDEYSAYPEPCESPPVSVNNLEHTTTAAATTKPRIGYVHSAEHLFECER
LPRIRRRCLLVHGLIKCYGLLKSLYIIRPPQATRNDLLTFHSEDYVDFLETCESAKDLET
TDILDKAIEYNLMDDCPLTDRIFTLVKHIAGGTLSAARALTEGQCDVAIHWEGGWHHAQR
SEAAGFCYVNDVVLGILQLRRRFERVLYVDLDVHHGDGVQDAFCGTDKVATVSFHQYEPC
FYPGTGDCKDVGIGRGRGYSVNVPLRSGMRDPTFVSVVTTVLAEVQRRYDPVAVVCQCGA
DCLSGDPLGAFNLTADALSKCLSFVQAWKLPLLVLGGGGYSFANVARCWTKLTATLLGVN
LDEEIPEHGFLMEYGPGYELGVEPGRRPDLNDSDYVDGVVRAVLSQVRHMDPP
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgtacgatcaatggtattataccacgttcgaagaggatgaatactctgcgtacccagaa
ccgtgcgaatcgcctccggtgagtgtcaacaacttggagcacaccaccaccgccgccgcc
acaacgaaacctcgtatcggctacgtgcacagcgccgaacaccttttcgagtgcgaaagg
ctgccccgcatccgccgcaggtgcctccttgttcacgggctgatcaagtgctacggtctc
ttgaaatccctttacataatccgccctccgcaggcgacccggaacgatttgttgaccttc
cactcggaagactacgtcgactttctcgaaacgtgcgagtcggcaaaggacctcgaaacg
acggatattctggacaaagccatcgaatacaacctcatggacgactgtccgttgaccgat
cgcatattcacgctcgtgaaacacatcgccggcggcacgctaagcgccgctcgtgccctg
accgaaggacagtgcgacgtcgcgatacactgggaaggcggctggcaccacgctcagagg
agcgaagccgccgggttctgctacgtcaacgacgtcgtgctggggatcctccaacttcgt
cgccgcttcgaacgggtcctctacgtcgacttggacgtgcaccacggcgacggcgttcag
gacgcgttctgcggaaccgacaaagtggccactgtgtcgttccaccagtacgaaccctgc
ttctacccgggaaccggagactgcaaagacgtcggcatcggaagaggccgcggctactcg
gtgaacgtccctcttcgcagcggtatgcgagacccgactttcgtgagtgttgtcacgact
gttctggccgaagttcagcgtcggtacgatcctgtggcagtcgtgtgtcagtgtggggcc
gactgtctttccggcgatccgctcggtgcctttaatctgaccgcggacgctctgtccaag
tgcctgagttttgtgcaggcttggaagttgcccttgctcgtgctgggagggggtggctac
tctttcgctaacgtggcgcggtgttggacgaagctcaccgcgacactgttgggcgtgaac
ttggacgaggagattcccgagcacggctttctgatggagtacggaccagggtacgagctg
ggtgtcgagccgggacgccgacctgacctgaacgattccgactatgtggacggagtcgtg
cgtgccgtgctctcgcaagtacgtcacatggacccgccgtaa

DBGET integrated database retrieval system