KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW007961Help
Entry
IscW_ISCW007961   CDS       T01131                                 

Definition
ubiquitin specific protease, putative (EC:3.1.2.15)
Orthology
K11837  
ubiquitin carboxyl-terminal hydrolase 6/32 [EC:3.1.2.15]
Organism
isc  Ixodes scapularis (black-legged tick)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 1583 aa AA seqDB search
MGARDSKPCSITNEDASKRVTESELRRLRDAFKRASNLSGIITRQAFIKEVLGEFVPLKL
AEHIFQACGGTSKGINFKDLLCGLVLLTRGTREERIRFIFNLYANEGGTHIYKNDMIKLV
LACDGGYIPEAVADCFIESEKVTFEEFHEWLLQHPEATSLTRWLLSEPSSVTLSNDLETP
TFYQTLAGVTHLEETDIIELEKRYWQLKTQSRTGKFDLETLGPLISPPVPAALCQGIFNA
FDENRDSHIDFKEMACGVSACCRGPLTERQKFCFKVFDQDMDGMLSYEEVRNMLSLLTVL
QQEERVTNDEDGTITLDEYLVWTVGNSLTLSLLNLMFQVCHVVFGLRPSSREEEGEIIRT
WLRREAFRRRPSPSPKMKLLLWVSGVKVTSRLQRKIESSVARSATDDGSVVLASVTSLSS
DGHTLDLVVPFDAQSAANCPSVPGSPKCPSVSRKLLPAFPQRPPSIDNTGLIVPNTVKAM
VLTGEGGRLQRQVPLCQGRDFEAVPEAVWRALFQWYGGSPALPRQVVRPTPGASPELELY
PITLRLYRHQAPPGPPRHPNSSWTAVVGSPSLTPKRYLAYLASFSRAATLRQVFDFLCTR
LRLRPEDSRLWQLNDENNLTLLEEEGLTLEQLGIEDGEQILIEVRNKDQTWPEEMSCIIN
SKIDQKNQGPTEKGATGLNNLGNTCFMNAALQCVSNTRPLTQYFIGEKHLYELNRLNPLG
MKGHIAKRYGDLVHDLWSGTSKTVAPLKLRWTIGKYAPRFNGFQQHDSQELLAFLLDGLH
EDLNRVQEKPYVELKDSAGRPDDEVAREAWENHALRNRSVVVDLFHGQLQSTVTCKVCSH
TSVRFDPFNFLSLPLPMESCVHVEVVVVRLDGSAPIRYGLQLNPDERYATVKRHLGALCG
LAPAHMLLAEVCGAVVRALLPDERRVQATALGAGLFAYEVPGDAAVFEEDLAHREPQTLT
QIQRMVVTCANGVHPAKMPLANGSVPSGDGASTARSLGDLSTGGGGAGETPAQVTGLFCC
SRLAAHGGTPCAPYIASLGRGFLRVLNPDERYATVKRHLGALCGLAPAHMLLAEVCGAVV
RALLPDERRVQATALGAGLFAYEVPGDAAVFEEDLAHREPQTLTQIQRMGQGSEGVPERP
DTPGSTSSRNVVPTVSWNGVGLFAEISPGMTSSLTSNSSAADLSELARRNFVVAYHRKMM
RQDVYFLSSQKTRPTLFGMPLVLPCHEGTSRQDLYRLVWTQVARLVSPLPPAEAAVPNHA
QDCDDSLGYEYPFTLKAVQKDGFMCAWCPWYKFCRGCQIECDDADFNFSTVYLSIDWDPT
ALHLRYQASQERIIHLKRFQLLNGKWVKSQKIVRFPFKDFDPTDYLSPVPRKAALSFQRR
KRQSSPAGPKAGARPASPLVRRMPEPGLLLRQSASSPARGRPEVAQLRHSAQQKESPPTT
RGLSNGDVRHDACHNSVVLDGTQETGTGGEPQDHHKHRLHPGYSPLDLKYQMYALACHTG
ILGGGHYVSYACNPNNRWYCYNDSSCKEVQLDQIDSDSAYMLFYEREGIDYEAYMPNTEG
KVPDARDIDDEFENDFRKMCVLQ
NT seq 4752 nt NT seq  +upstreamnt  +downstreamnt
atgggggccagagattccaagccctgctcaatcacgaatgaggatgcctccaaaagagtg
acagaatctgaactgaggcggctgagggatgccttcaagcgggcctcgaatctgagtggc
atcatcaccaggcaggcattcatcaaggaggtgcttggagaatttgtgccactcaagcta
gctgagcacatcttccaggcatgtggtggcacaagcaagggcatcaatttcaaggacctc
ctctgcggcctggtgctgctgacgcgaggcacccgggaggagcggataagattcattttc
aacctgtacgcaaacgaaggaggcacacacatctacaagaacgacatgatcaagcttgtc
cttgcctgcgacggcggttacattccagaagcggtggccgactgcttcatcgagagcgaa
aaggtgacatttgaggagttccacgagtggctgctgcaacaccccgaggccacgtctctc
acccggtggctgcttagtgaaccctcttcggtgaccttgtccaacgatctcgagacaccg
accttctaccagacacttgccggggtcacgcacctggaagagacggacatcatagagctg
gagaagcggtactggcagctcaagactcagtcgaggacgggcaagtttgacctggagaca
ctggggccactcatttcgccgcccgtgcctgctgccctctgccaggggatcttcaatgcc
ttcgacgagaacagggacagccacatcgacttcaaggagatggcgtgtggcgtgtcggcc
tgctgtaggggacccctcaccgagcggcagaagttctgtttcaaggtgttcgaccaagac
atggacggcatgctgtcctacgaagaagtcagaaacatgctctcacttctgacggtgctc
cagcaggaagagagggtcacaaacgatgaggacgggaccattacgctagacgagtacctt
gtttggacggttgggaacagcctcaccttgagtctactcaacctcatgtttcaggtgtgc
catgttgtgttcgggctgaggccctcatccagggaagaagagggtgagataataaggaca
tggctgaggagggaggcctttcggcggcgtccatccccaagtccaaagatgaaactcttg
ctctgggtgagcggggtgaaggtgacgagccggctgcagcgcaagatcgagtccagcgtg
gcgcgctccgccacggacgacgggagcgtggtgctggccagcgtgacgagcctgtcctcg
gacggccacaccctggacctcgtggtgcccttcgacgcccagtcggccgccaactgcccc
agcgtgccgggctcccccaagtgccccagcgtgtcgcgcaaactcctgccagcgtttccc
cagcggccgccctccatagacaacactggcctcattgttcccaataccgtcaaggcgatg
gtgctgacgggggagggcggccgcctccagcgtcaggtgcccctgtgccaggggcgggac
ttcgaggcggtgccagaggcggtgtggcgcgccctgttccagtggtacgggggctctcct
gcgctgccccggcaggtggtgcgccccacgcccggcgccagtcccgaactggagctgtac
ccgatcaccttgcgcctgtaccggcaccaggcgccgccggggcccccccgacaccccaac
agcagctggacggccgtggtgggcagcccgagcctgacccccaagcgctacctggcgtac
ctggcgtcgttcagccgggcggccaccctgcgccaggtgttcgacttcctctgcaccagg
cttcgcctgcggccggaggacagccgcctctggcagctcaacgacgagaacaacctgacc
ttgctcgaagaggagggcctcactttagaacaacttggcatagaagacggtgaacaaatt
ctcattgaagtaaggaacaaagaccagacgtggcctgaggagatgtcctgcataattaat
tccaagatcgaccaaaaaaaccaaggccccacggagaaaggggccactgggctgaacaac
ctgggcaacacgtgtttcatgaatgccgcgctgcaatgcgtcagcaatacgcggccactc
actcaatacttcatcggcgagaagcacctttacgaactgaacaggttgaatcctttgggc
atgaaaggccacattgccaagcggtacggagacttggtgcacgatctctggagcggtact
tcgaagacggtggcaccactcaaactcaggtggacgatcggcaagtacgccccgcggttc
aacggcttccagcagcacgactctcaggagctgttggcattccttttggatggcctacac
gaagatctcaatagggtccaggaaaagccatacgtggagctgaaggacagcgcggggcgc
ccggacgacgaggttgcgcgagaggcgtgggagaaccatgccctacgcaaccggtctgtg
gtggtggacctgttccacggccagctgcagtcgacggtgacctgcaaggtgtgcagtcac
acgagcgtgcgcttcgaccccttcaacttcctctccctgcccctgcccatggagagctgc
gtacacgtggaggtggtcgtcgtgcggttggacggcagcgctcccatcaggtacggactg
cagctgaatccggacgagcggtacgcaacggtgaagcggcacctgggggccctgtgcggc
ctggcgcctgcacacatgctgctggccgaggtgtgcggggccgtggtgcgggccctgctg
ccggacgagcggcgggtgcaagccacggccctcggggccggcctcttcgcctacgaggtg
cctggcgacgccgccgtcttcgaggaggacctggcccacagggagccccagaccctcacc
cagatccagaggatggtggtcacctgtgccaacggcgttcaccctgccaagatgcccctg
gccaacggtagcgtaccttccggggacggcgcatccacggcacgaagtctgggggacctc
agcacgggaggaggaggtgcaggcgagacccccgcacaggtgacgggcctcttctgctgc
agccgcctggcggcccacgggggcactccgtgcgccccgtacatcgcgagcctcggacgt
gggttcttgagggtcctgaatccggacgagcggtacgcaacggtgaagcggcacctgggg
gccctgtgcggcctggcgcctgcacacatgctgctggccgaggtgtgcggggccgtggtg
cgggccctgctgccggacgagcggcgggtgcaagccacggccctcggggccggcctcttc
gcctacgaggtgcctggcgacgccgccgtcttcgaggaggacctggcccacagggagccc
cagaccctcacccagatccagaggatgggtcagggcagtgaaggagtccctgaacgtccc
gacacgcccggctcgacgtcctccaggaacgtggtgcccaccgtctcgtggaacggcgtt
gggctctttgccgagatctcgccgggcatgacgtccagcctgaccagcaactcttcggcg
gccgacctgtccgagttggcacggcgaaacttcgtggtggcctaccatcggaagatgatg
cgccaggacgtgtacttcctgtcgtcccaaaagacgcgtcccacgctgtttgggatgccc
ctggtgctgccctgccacgagggcaccagccgccaggacctgtaccgcctggtgtggacg
caggtggcgcgactggtgtcccccctgcctcctgcggaggccgccgtgcccaaccacgct
caagactgcgatgacagtttgggttatgaatatccctttacgctgaaagcggtgcagaag
gacggtttcatgtgcgcatggtgtccttggtacaagttctgtcgtggctgccagatagag
tgcgatgatgcggacttcaactttagtaccgtctacctatccattgactgggaccccacg
gcactccacctgaggtaccaggcctcgcaagagaggattatccacctgaagcggttccag
ctgctcaacggcaagtgggtcaagtctcagaagatagtgcgcttccccttcaaggacttc
gaccccaccgactacctgtcccccgtgccccgcaaggctgccctcagcttccagcgtcgg
aagcggcagtcgtcgccagccggtcccaaggccggcgcccgccccgcctcccctctagtc
cggcgcatgcccgaacccgggctgctcctgcggcagtccgcttctagtcccgccaggggc
cgcccggaggtggcccagctccggcactcggctcagcagaaggagagcccacctacgacg
aggggcctgtccaacggcgacgtgcggcacgacgcgtgccacaactcggtcgttctggac
ggcacccaggaaacgggcaccggcggcgagccccaggaccaccacaagcacaggctacat
ccgggctacagcccgctagacctcaagtaccagatgtatgccctggcgtgtcacacgggt
atcctgggaggcggccattacgtctcgtacgcatgcaatcccaacaaccggtggtactgc
tacaacgacagcagctgcaaggaagtccaactggaccagatagactcggactctgcctac
atgctgttctacgaacgggaaggcatagactacgaggcctacatgcccaacacagagggc
aaggtgccagacgccagggacattgacgacgagttcgagaacgactttcgcaagatgtgc
gtcctccagtag

DBGET integrated database retrieval system