KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW008434Help
Entry
IscW_ISCW008434   CDS       T01131                                 

Definition
hexosaminidase domain-containing protein, putative (EC:3.2.1.52)
Orthology
K14459  
hexosaminidase [EC:3.2.1.52]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
Other glycan degradation
Class
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:isc00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 474 aa AA seqDB search
KQVLVHFDLKGAPPKADFYDAAFPLLRKLGATGVLMEYEDMFPYWGALKALSAKNAYNRS
ELAHILSVAHKNNLKVVPLVQTFGHLEFALKLHEFIELRELSDSPQALCPSLNSSLGLVK
TMLDQVLSLHPDTEYVHIGCDEVYSLGRCPRCEERLQLPGTSRDTLFLDHVKSVAQHVVR
AGVRPIMWDDMLRGMEPDSVRRWNASQLVDLMVWSYTPNISKDLDAKIWDKYSQFGGVWV
ASAFKGATGAKQLLPDIGYHLKNHHSWLRALEDHGQSWPLRGIALTGWQRYDHFATLCEL
FPASIPSLAANLVYLQRGRLDTPELHSIKALLGCNRPIPVFGHTDAHFLFCRFPGAKVLT
GVQQLTGLLRQKQIMEKNSNYVGWLGSYNIRHLFGSPDHVRDATRNLSELLGTANHLQRF
LGDALSEVYDSYTVAEWMGIFLEPVLRQLNLLDQQTQDLLNINTWPRRPLETTN
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
aagcaagtattggtacattttgatctgaaaggcgcacctcccaaggcagacttctacgac
gcagcatttccgctcttacggaagcttggggccactggcgtgcttatggaatatgaagac
atgtttccttactggggagcattgaaggccctgtctgcaaagaatgcttacaaccgcagt
gaacttgctcacatattgtctgttgcacataaaaacaacttgaaggtagtgccactggtg
caaaccttcggccacctagagtttgccctcaagctgcacgagttcatagaattgcgagag
ctgagcgacagcccacaagcgctgtgcccatccctcaacagttcccttggcctggtgaaa
accatgcttgaccaagtgctcagcctgcacccagatacagagtatgtgcatattgggtgc
gatgaagtctactccctgggccggtgtccacgctgcgaggaaaggctccagctgccgggc
acgtctcgggacactctctttctcgaccatgtgaaaagtgtggcccagcacgttgtgcgt
gcgggggtgcgtccaattatgtgggacgacatgctgcgtggcatggagccagacagtgta
cgccgctggaatgcatcccagctcgtggacctcatggtctggagctacacccccaacatc
agcaaggacctcgatgccaagatatgggacaaatattcccagtttggaggcgtgtgggtg
gcaagtgctttcaagggtgcaacaggtgccaagcaactcctgccagacatcggatatcac
ctgaagaatcaccactcgtggctcagggccctggaggaccacgggcagagttggccactg
cgtggtattgcactgactggctggcagcggtacgaccactttgccaccctctgcgagctg
tttcctgcaagcataccctctttggcggccaacctggtttacctccaacgtggacgcctg
gatactcccgagttgcattcaatcaaggcgctgcttggctgcaacaggcccatccctgtg
tttggtcacacggacgctcacttcctattttgccgctttcctggagccaaggtgctcact
ggagtgcagcagctgacgggacttcttaggcagaagcagatcatggagaagaactctaat
tatgtgggctggctcggtagctacaatattcggcacttatttggaagtcccgaccacgta
cgtgatgccactcgaaacttaagtgagcttttgggcacagcaaatcacttgcaaagattt
ttgggcgacgcactaagtgaagtttatgattcatacacagtggcagagtggatgggcatc
ttcctggagccagtattgagacagctgaacctgctagaccagcagactcaagacttgctg
aatattaacacctggcctcgcaggcctctggaaactaccaactga

DBGET integrated database retrieval system