KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW008644Help
Entry
IscW_ISCW008644   CDS       T01131                                 

Definition
amsh, putative (EC:3.1.2.15)
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:isc00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    IscW_ISCW008644
Enzymes [BR:isc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     IscW_ISCW008644
Peptidases [BR:isc01002]
 Metallo Peptidases
  Family M67
   IscW_ISCW008644
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 444 aa AA seqDB search
ISQCLQLCILHFRMPSASRGLEKYDPHVKIRNLGKAGSALEIDESVPLKRYFGSGNTMLR
MAESYQKQGDLESAFILYTKYITLFVEKISKHPEMSSASLTEWNITKKRVKEVFPIAEKL
KSKLLEKYTKEYEILLKNKLAKTRKEITRALDMSCPLQERQEAEEAEEERRRQEQLERLM
YDQQKLFALQSGRSRRTREPSPERPATPTPGAVSPSDVYPTLLDLENGFLDRLPRPRTPP
VVRRAIPPVDRSTKPSPLLSPEPFFLGTQGLRSVVVPGGLFAKFLYLSKQNTEKNVETCA
ILAGKFSGNQLSISHLLVPKQSGTADSCSTENEEEVLEYQDQKGLDTVGWIHTHPTQTAF
MSSVDLHTHCSYQLMLPEAVAIVCSPKYEENKIFSLTVEHGLPFISGCHATGFHPHPKDP
PLYEECKHVRIDDKAPVTVVDLRA
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atttcacaatgccttcagttgtgcattttgcatttcaggatgccttcggccagcaggggc
ttggagaagtatgatccccacgtcaagatccgcaacttggggaaagccgggagtgcccta
gaaatcgacgagagtgtcccgctgaagcgatactttgggtccggcaatactatgctcagg
atggcagagtcttaccagaagcaaggggacctggaaagcgccttcatattgtacacaaag
tacattaccctcttcgtcgaaaaaatttccaaacatcctgaaatgagcagtgcttctttg
accgagtggaacataactaagaagagagttaaagaggtctttcccatagcagagaaactg
aaatccaagctccttgaaaagtacaccaaagaatatgagattcttttgaagaataagctc
gcaaaaacgcggaaagaaattacgcgagcgctagacatgtcatgtcccctccaggagcgg
caagaggccgaggaggccgaggaagagcgccgcaggcaggagcagctggagcggctcatg
tatgaccagcagaagctgtttgcactccagtccgggcggtcccggcgcacgagggagccc
agccccgagcgaccggccacgcccacccccggcgccgtgtccccgtcggacgtgtacccg
acgctgctcgacctcgagaacgggtttctggaccggctgccgcgacccaggacgcctcct
gtggtgaggcgagcgatccctccggtggatcgcagcaccaagccctcaccgctgctgagc
ccggagccgttcttcctcggcacccagggactgaggagcgtcgtcgtccccggcggcctc
ttcgcaaagttcctgtacctctcgaagcaaaacaccgagaagaacgtggagacctgtgcc
atcttggccgggaaattttctgggaaccagctgagtatcagccaccttttggtgcccaag
cagtcggggacagctgattcctgctccacagagaacgaagaagaagttcttgaataccag
gaccagaagggattggacactgttggctggatccacacccatccgacacagacggccttc
atgtcaagtgtagacctgcacacgcactgcagctaccagctgatgcttccagaagccgtt
gcaattgtgtgctcccccaaatatgaagagaacaagatcttcagcttaacagttgagcat
ggactgccattcatctccggttgccatgccactgggttccatcctcaccccaaggatcca
ccactttacgaggaatgtaagcatgttcgaatagacgacaaggctccggtgactgtggta
gaccttcgagcatga

DBGET integrated database retrieval system