KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW008731Help
Entry
IscW_ISCW008731   CDS       T01131                                 

Definition
dihydrolipoamide acetyltransferase, putative (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:isc01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:isc00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:isc00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 351 aa AA seqDB search
MPAGDELRVIKCPQLAESLSEGDIRWIKGVGDTVKEDEVICEVETDKTSIPVHAPASGVI
LELLVEDGTTIQPGKDIMRLQIGGGAPAASRPAAPAAPAAAPSPAAPATGSPVSGPIPTT
PPPAPAKPSGPMSSTPVSQIQMPGPVTASAGADAGDSVPVGARTEQRVKMNRMRQRIAQR
LKDAQNTYAMLTTFNEVDMTSVIQMRNKYKDTFLKKHGVKLGFMSPFVKAVAFALQDQPV
VNAVIDEQEIIYRDYIDISVAVSTPKGLVVPVIRNCEGMNYADIEKAINVLGEKARTGSL
AIEDMDGGTFTISNGGVFGSMFGTPIINPPQSAILGMHAVFERPVNVAGKV
NT seq 1054 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcaggcgacgagttgcgggtcatcaagtgtccacagctggccgaatcgctaagc
gagggtgacatcaggtggatcaaaggcgttggcgacacggttaaagaagacgaggtgata
tgcgaggtagaaaccgacaagacatcaatccctgttcacgccccagcaagcggagtcatc
ctcgagcttctggtggaggatggtacgaccatacagcccggcaaggacatcatgaggctc
cagattggaggtggcgccccggctgccagcagacccgccgcacccgctgcacccgctgcc
gcaccctccccggcagcgccggcaacagggtctcccgtctcgggacccatcccgacgacg
ccccctccggcccccgccaagccctctggccccatgtcttccaccccggtctcccagatc
cagatgccaggaccggtcacggcctctgcgggagcagacgccggagactccgtacctgtc
ggagctcggacggaacagcgggtgaagatgaaccgaatgcgacagaggatcgcccagcgc
cttaaggatgcccagaacacttatgcaatgcttacgacgttcaacgaagtggacatgacg
agcgtcattcagatgcggaacaagtacaaagacaccttcctcaagaagcacggcgtcaag
ctgggctttatgtctcccttcgtcaaggcagtggcctttgccctccaggaccaacctgtg
gtgaatgccgtgatcgacgagcaggagatcatctacagggactacatcgacatcagtgtc
gcggtatccacgccaaagggtctggtcgttccggtgatccgcaactgcgagggcatgaac
tacgcggacattgagaaggcgatcaacgtcctgggcgagaaggcccgcacgggcagcctg
gccattgaggacatggacggcggcaccttcaccatcagcaacggcggcgtctttggctcc
atgtttggcacgcccatcatcaacccgccccagtctgccatcctcggcatgcatgccgtc
ttcgagcgtcccgtcaacgtcgccgggaaggtgg

DBGET integrated database retrieval system