KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW008731Help
Entry
IscW_ISCW008731   CDS       T01131                                 

Definition
dihydrolipoamide acetyltransferase, putative (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:isc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    IscW_ISCW008731
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    IscW_ISCW008731
  Amino acid metabolism
   00310 Lysine degradation
    IscW_ISCW008731
Enzymes [BR:isc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     IscW_ISCW008731
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 351 aa AA seqDB search
MPAGDELRVIKCPQLAESLSEGDIRWIKGVGDTVKEDEVICEVETDKTSIPVHAPASGVI
LELLVEDGTTIQPGKDIMRLQIGGGAPAASRPAAPAAPAAAPSPAAPATGSPVSGPIPTT
PPPAPAKPSGPMSSTPVSQIQMPGPVTASAGADAGDSVPVGARTEQRVKMNRMRQRIAQR
LKDAQNTYAMLTTFNEVDMTSVIQMRNKYKDTFLKKHGVKLGFMSPFVKAVAFALQDQPV
VNAVIDEQEIIYRDYIDISVAVSTPKGLVVPVIRNCEGMNYADIEKAINVLGEKARTGSL
AIEDMDGGTFTISNGGVFGSMFGTPIINPPQSAILGMHAVFERPVNVAGKV
NT seq 1054 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcaggcgacgagttgcgggtcatcaagtgtccacagctggccgaatcgctaagc
gagggtgacatcaggtggatcaaaggcgttggcgacacggttaaagaagacgaggtgata
tgcgaggtagaaaccgacaagacatcaatccctgttcacgccccagcaagcggagtcatc
ctcgagcttctggtggaggatggtacgaccatacagcccggcaaggacatcatgaggctc
cagattggaggtggcgccccggctgccagcagacccgccgcacccgctgcacccgctgcc
gcaccctccccggcagcgccggcaacagggtctcccgtctcgggacccatcccgacgacg
ccccctccggcccccgccaagccctctggccccatgtcttccaccccggtctcccagatc
cagatgccaggaccggtcacggcctctgcgggagcagacgccggagactccgtacctgtc
ggagctcggacggaacagcgggtgaagatgaaccgaatgcgacagaggatcgcccagcgc
cttaaggatgcccagaacacttatgcaatgcttacgacgttcaacgaagtggacatgacg
agcgtcattcagatgcggaacaagtacaaagacaccttcctcaagaagcacggcgtcaag
ctgggctttatgtctcccttcgtcaaggcagtggcctttgccctccaggaccaacctgtg
gtgaatgccgtgatcgacgagcaggagatcatctacagggactacatcgacatcagtgtc
gcggtatccacgccaaagggtctggtcgttccggtgatccgcaactgcgagggcatgaac
tacgcggacattgagaaggcgatcaacgtcctgggcgagaaggcccgcacgggcagcctg
gccattgaggacatggacggcggcaccttcaccatcagcaacggcggcgtctttggctcc
atgtttggcacgcccatcatcaacccgccccagtctgccatcctcggcatgcatgccgtc
ttcgagcgtcccgtcaacgtcgccgggaaggtgg

DBGET integrated database retrieval system