KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW008740Help
Entry
IscW_ISCW008740   CDS       T01131                                 

Definition
cytochrome C, putative
Orthology
K08738  
cytochrome c
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:isc00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    IscW_ISCW008740
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 115 aa AA seqDB search
MVFRAAMVEIPKGDPEKGKKIFVQRCAQCHTVEAGGKHKTGPNLHGLIGRKTGQAAGFSY
TDANKSKGITWNRDTLFIYLEDPKKYIPGTKMVFAGLKKTQDRGDLIAYLEQSTK
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtcttcagagcagccatggtcgaaattcccaagggcgacccagagaagggcaagaag
atcttcgtgcagcgctgcgcccagtgccacacggtggaagccggaggcaagcacaagact
ggtcccaatctacatgggctcatcggacgcaagacgggacaggcggcaggcttcagctac
acagacgccaacaagagcaaaggcatcacctggaaccgggacacattgttcatctacctg
gaagaccccaagaagtacattccgggcacaaagatggtgtttgcgggcctgaagaagacg
caggaccggggagacctgattgcctacctggagcagtccaccaagtag

DBGET integrated database retrieval system