KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW008866Help
Entry
IscW_ISCW008866   CDS       T01131                                 

Definition
(RefSeq) transcription factor IIH (TFIIH), putative
  KO
K03144  transcription initiation factor TFIIH subunit 4
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
isc03022  Basal transcription factors
isc03420  Nucleotide excision repair
Module
isc_M00290  Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:isc00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    IscW_ISCW008866
  Replication and repair
   03420 Nucleotide excision repair
    IscW_ISCW008866
Transcription machinery [BR:isc03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     IscW_ISCW008866
DNA repair and recombination proteins [BR:isc03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     IscW_ISCW008866
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tfb2
Motif
Other DBs
NCBI-GeneID: 8035432
NCBI-ProteinID: XP_002411342
VectorBase: ISCW008866
UniProt: B7Q3P4
AA seq 218 aa AA seqDB search
MSLSAPSSSLKCNDLHAYLKTLSPATLDQLYTHPATCLAVFRELPIISRHYIMRLMFVDQ
PVPQAVVSSWNEQKYVKEHLESLEALTALHIWADSSLPGGLPGWSLSGVFRKNIQIALLG
GGQPWAVYSTLEKDKHGRDAQFLDRYAMERWECVLHFMVGCHTKEGISADAVRILLHAGL
MKSEEEEGSAPLITMEGFQFLLMDTASQVWHFVLQYLD
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgtcggcgccgagcagttcgctgaaatgtaacgatctgcacgcttacctgaag
accctgtcgccggcgacgctggaccaactctacacgcacccagcaacatgcctcgccgtc
ttccgggagttgccgatcatttcccgccactacatcatgcggctcatgttcgtcgaccag
ccggtgccgcaggccgtcgtgtcatcgtggaacgagcagaaatacgtcaaggagcacttg
gagtccctggaagcgctgacggcactgcacatctgggcggactcaagccttcccggaggc
cttcctggatggtcgctgagtggtgtcttccggaagaacatccaaatcgccctgcttgga
ggtggccagccgtgggcagtgtacagtaccctggagaaggacaagcacggccgggacgcg
cagttcctcgaccggtatgccatggagcggtgggagtgtgtgctgcacttcatggtgggc
tgccacaccaaggaaggcatcagtgcggacgcagtgcggattctccttcatgcggggctc
atgaagtcggaggaagaagagggcagtgcccccctgatcaccatggaagggttccagttt
ctcctgatggacaccgcttcccaggtgtggcactttgtgcttcaatacctggac

DBGET integrated database retrieval system