KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW008869Help
Entry
IscW_ISCW008869   CDS       T01131                                 

Definition
triosephosphate isomerase, putative (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:isc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    IscW_ISCW008869
   01230 Biosynthesis of amino acids
    IscW_ISCW008869
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    IscW_ISCW008869
   00051 Fructose and mannose metabolism
    IscW_ISCW008869
   00562 Inositol phosphate metabolism
    IscW_ISCW008869
Enzymes [BR:isc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     IscW_ISCW008869
Exosome [BR:isc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   IscW_ISCW008869
  Exosomal proteins of bladder cancer cells
   IscW_ISCW008869
  Exosomal proteins of melanoma cells
   IscW_ISCW008869
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 247 aa AA seqDB search
MSGRKFCVGGNWKMNGNKSSIKEICDMLKTAKLDPNTEVVLGCPAPYLDYVRRILPAAIA
VSAQNCYKVEKGAFTGEISPAMIKDCGATWVILGHSERRNVFKESDELIGDKVHHALESG
LNVIACIGELLEEREAGKTEEVVYRQTAAIAAKVTDWNRVVLAYEPVWAIGTGKTASPEQ
AEVHAQLRQWLSKNVSPDVAKKVRIQYGGSVTAANCQELAKKPDVDGFLVGGASLKPEFV
EIINARQ
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgtccggccgaaagttctgcgtcggtgggaactggaaaatgaacggaaacaagagcagc
attaaggagatctgcgatatgctgaagacggccaagctggaccccaacaccgaggtggtc
ctcggctgtccggccccgtatctggactacgtccggaggatcctgccggccgccatcgcc
gtgtcggcgcagaactgctacaaagtcgaaaaaggcgctttcaccggcgagatcagtcct
gccatgattaaagactgcggtgcaacttgggtgattctcggtcattcggaaaggaggaac
gtgttcaaggaatccgacgagctgattggagacaaggtgcatcatgccctggagtccggc
ctgaacgtcattgcctgcatcggtgagctgctggaggagcgggaggccggaaagacggag
gaggtggtctaccggcagacagcggccattgcagccaaggtcacggactggaaccgggtg
gtgctggcctacgagccggtctgggccattggaacgggcaagactgcttcccccgaacag
gcagaagtgcatgcacagctgaggcagtggctgagcaagaacgtgtcccccgacgtggca
aagaaagttcgaatccagtacggaggatcggtgactgcggccaactgccaggagctagcc
aagaagcccgacgtagacggattcctggtgggaggagcctcactgaagccagagtttgtc
gagatcattaacgctcgccagtaa

DBGET integrated database retrieval system