KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW008894Help
Entry
IscW_ISCW008894   CDS       T01131                                 

Definition
(RefSeq) ubiquitin specific protease, putative
Organism
isc  Ixodes scapularis (black-legged tick)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
VectorBase: 
UniProt: 
AA seq 1161 aa AA seqDB search
MPLQQQREETARLVLSQLKEITGVEDAAILEQALEASRTRSGDYDLSQAVSMLVDEDATA
SPAASTHGTQVAAKPELSGDGVALTSNNGGPSSSPQKRPAKVIDLTAAEGDDLQKAIALS
LQEQQVAGVSAEEQDISRALEQSLGSGGKRKRGADAWQDPANPHERRRQGDWPVGIKNVG
NTCWFSAVMQSLFHLRVFRRLVLAFEPVNVPSGQPAQERRSLGLMQELRPLFALLGATRR
KYVDPGRALELLREAFAGSGAGAQGGSQGQPAPAAQSQQQQDVSEFTHKLLEWLEEAFQL
ARCTPTSEVGMPKLDQTNPMLDLFYGRFRCEGESEGLRFSREEAFGQYPLQVSGFSDIHE
SLEAATTNLEPEALTAPGMRRLGQESWFTKLPPVLVFELSRFRFNQQLGKPEKIHHQLDF
PEQLYLDRYMEYNKNITRSKREEVRRLKAEWERLHKCLNKYIQYGSGPKRVPLQDVLQYT
LEFVETKAAMHKAEDVPYRLHAVLVHEGQAASGHYWAFVYCPRRSVWLKFNDVTVTEVSW
AELVRDSVGGHHCTSAYCLLYVDRNNRDLFDGGFGLCDESLAGEALARSLQSEGLGLGSP
SSSPPDEGHARDQSPRSSFDGGPRPRHVAEPELRMLQTCLRRWRTEVEHDVKGAVPTACG
AGARGPGRLGPLLGLRVLPRRSVWLKFNDVTVTEVSWAELVRDSVGGHHCTSAYCLLYVD
RNNRDLFDAENLHIFELTVSGVRRRCARAEVKNSELELPSDLAQFVEEDNEAFRRELEQW
DRSHKDCPDGASSEIVVTPLQQQKESPAAERVCSAAEWSVSGTAVPWPEVQLEHARLAQG
SFQGVRLAQLVPTLTTEGPRAALAKALDQELARLQRLAKHAPCGEASQEPRLHHPGLFLL
LNGIPVQPHLRRVLLEQFAHPDLEGDPTGRLLRQEALQCLAQLRGGSESEEAAEEAAYRG
WHALYARFRQLATALAVGLDRLWAGRLPEALSLLAGACALNEALQGGPPPAGPKARHLGL
NPRLLDHCRRLALLELNEKCASQFEEGSLEEGLEALRLMSQAVLPCLAPLLAPQASSRDA
RAIEEVRSRWCAMLGLAMTEEKQERLQELLSKLLDPGAELPVPAVAPLTVPRLPDLGAAF
ETAMRRLTASGQLEAALSSAS
NT seq 3486 nt NT seq  +upstreamnt  +downstreamnt
atgcccctgcagcagcagcgtgaggagacagcccggctggtgctgagccagctgaaggag
atcacgggggtggaggatgcggccatcctggagcaggccctggaggcgagccgcacccgc
tcgggggactacgacctctcccaggccgtcagcatgctcgtggacgaggacgccaccgct
tccccggccgcctccacccatggcacccaggtggcagccaagccggaactctcgggcgac
ggggtagccttaacgagcaacaacggcggtccgtcgtcctcgccgcagaagcggcctgcc
aaggtgatcgacctcaccgctgctgaaggagatgacttgcagaaggccattgccctctcg
ctacaggagcagcaggtggccggggtgtctgcagaggagcaggacatcagccgggccctg
gagcagagcctggggtccgggggcaagcgcaagaggggagccgatgcctggcaggacccg
gccaatccgcacgagcgcagacgccaaggggactggcccgtgggcatcaaaaacgtcggc
aacacctgctggttctccgcggtgatgcagtcgctgttccacctgcgcgtgttccgacgc
ctggtgctggccttcgagcccgtgaacgtgccaagcggccagccggcccaggaacggcgc
agcctggggctcatgcaggagctgcggcccctgttcgccctgctgggggccacccgccgc
aagtatgtggaccccggccgggccctggagctgctgcgggaggcctttgccggctcgggg
gctggggcccaggggggctcccagggccagcccgccccagccgcccagtcccagcagcag
caggacgtctcggagttcacccacaagctgctcgagtggctggaggaggccttccagctg
gcacgctgcacccccaccagcgaggtagggatgcccaagctagaccagaccaaccccatg
ctggaccttttctatgggaggttccgctgcgagggagagagtgaaggtcttcgcttctcc
cgggaggaggcctttggtcagtatcccctgcaagtgagtggcttcagtgacatccacgag
agtctggaggcagccacgaccaacctggagcccgaggctttgaccgcccccgggatgcgc
cgcctgggacaggagagctggttcaccaagctgccgcccgtgttggtgtttgagctgtct
cggttccgcttcaaccagcagctgggcaaaccggaaaagatccaccaccagttggatttt
ccagagcaactttaccttgacaggtacatggagtacaacaagaacatcacgcgtagcaaa
cgggaagaagtgcgccggcttaaggccgagtgggaaagactacacaagtgcctcaacaag
tacatccagtacggttccggtcccaagcgggtgcccctgcaggacgtgctgcagtacacc
ctggagtttgtggagaccaaggcagctatgcacaaggccgaggacgtgccgtaccgactg
catgcggtgctggtgcacgagggccaggccgcctcgggccactactgggccttcgtgtac
tgcccccggaggtccgtctggctcaagtttaacgacgtcacggtgacggaggtgtcctgg
gcagagctggtgcgggactcggtgggcggccaccactgcacctcggcctactgcctgctc
tacgtggaccgcaacaatagggaccttttcgatggagggtttggactctgtgacgagtcg
ttagcaggcgaggcactcgcccggtccctgcaaagcgaaggcctggggctgggctccccg
agcagctcccctcccgacgaaggtcacgcccgcgaccagagccctcggagctccttcgac
gggggtccccgccctcggcatgtggcggagccagagctgcgcatgctgcagacgtgtctg
cggcggtggcgcaccgaagtggagcacgatgtcaagggtgccgtaccgactgcatgcggt
gctggtgcacgagggccaggccgcctcgggccactactgggccttcgtgtactgccccgg
aggtccgtctggctcaagtttaacgacgtcacggtgacggaggtgtcctgggcagagctg
gtgcgggactcggtgggcggccaccactgcacctcggcctactgcctgctctacgtggac
cgcaacaatagggacctcttcgatgccgagaacttgcatatctttgaactcaccgtgtcc
ggggtgcgtcgccgctgtgctcgtgcagaggtgaaaaactcggagctggagctgccctcc
gacctggcccagtttgtggaggaggacaacgaggcgtttcggagagagctggagcagtgg
gatcggtcccacaaagactgcccggatggggccagcagcgagatcgttgtcacgccactc
cagcagcagaaggaatctccagcggctgagcgggtctgcagcgccgcggagtggagcgtt
tcggggaccgccgtgccttggccagaagtgcagctggagcatgcgaggctggcacagggc
tccttccagggagtgcgactggcccagctggtgcccaccctgacaacggagggcccccgc
gcggccttggccaaggccctggaccaggagctggcgcgcctgcagcggctggccaagcac
gccccctgcggggaggcatcccaggagccccggctgcaccacccggggctcttcctactc
ctcaatggcatccccgtgcagccacacctgcgcagggtcctactagagcagttcgcacac
ccggacctcgagggggaccccacagggaggctcctcaggcaggaggccctgcagtgcctg
gcacagctcaggggtggctccgagtccgaggaggcggcggaggaggcagcgtaccggggc
tggcacgccttgtacgcgcgcttccggcagctagccaccgcccttgccgtagggctggac
cggctgtgggcggggcgcctgcccgaggccctgtcgctgcttgcgggagcctgcgccctc
aacgaggccctgcagggggggccgcccccggcagggcccaaggcccgccacctgggcctc
aaccccaggctgctggaccactgccgcaggctggcgttgctggaactgaatgagaagtgt
gccagccagttcgaggagggcagccttgaagaggggctcgaggcccttcggctcatgtcc
caggcggtgctgccctgcctggcacccctgctggccccacaggcgtcgtccagggatgca
cgcgccatcgaggaagtccgcagccgctggtgcgccatgctgggcctcgccatgaccgaa
gagaagcaggaacggctacaggaactgctcagcaagctgttggaccccggggcagagctc
cccgtccctgcggtcgcccccctgaccgtcccacgcctgcccgaccttggggctgccttt
gagaccgccatgcgccgccttactgccagcggacagctggaggctgccctctcttccgcc
tcttag

DBGET integrated database retrieval system