KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW009053Help
Entry
IscW_ISCW009053   CDS       T01131                                 

Definition
fatty acid synthase, putative (EC:2.3.1.85)
Orthology
K00665  
fatty acid synthase, animal type [EC:2.3.1.85]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
Fatty acid biosynthesis
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Fatty acid biosynthesis, elongation
Class
Metabolism; Overview; Fatty acid metabolism [PATH:isc01212]
Metabolism; Lipid metabolism; Fatty acid biosynthesis [PATH:isc00061]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 2453 aa AA seqDB search
MADEDVVITGFSAYFPQANHLAEFRKKLYDGVDMVTDDEARWPRGLLGLPERSGKIRDLS
QFDAQFFGVHPKQAHVMDPQLRLFLETSYEAIVDAGYDPGTLRGRKIGVFMGSSESETDE
AFNVDTDKIDGYALVGCCRAMFSNRVSYSLDFNGPSFTVDTACSSAMTALNQAMLALRSG
QCEAALVGGSTLTLKPTTALNFYRLGMLSPDGMCKAFDANGKGYVRSETVGVFFLQRVSE
ARRIYAKLVHVKANADGFKAEGITFPSGRAQEALLRDVYEEAGVDPRSVSYVEAHGTGTK
VGDPQEMSAISNVFCGEGRKEPLLIGSVKSNMGHSEGASGICSFAKVILSMETGTIPGNL
HFNEPNPGIPSLNDGSIRVVDRHMPFPGGLVGVNSFGFGGANVHTILEANPGPHVDSFPR
EKPQLPRLVLLAGRTQESLTATLDRLEADGPLPDPAYALLNRVGQPNMTQFPFRGYSVVA
VDGSREPIKGVEVGPSLPLVSLAQAPQPLQYCIEGGILQHTRRVCRLIRRSTSSCALRID
LIDLITSDNANNRRCLLGHGWQDGGRCAFPQVALVSMLKAVGVEPDGIVGHSVGEIGCAF
ADGGFTAEQTVLCAYWRGRCVELGNLPKGAMAAVGLTWEQAKQRCRNGVIPACHNAEDSV
TVSGPAEAVAELVAQLKAENVFAREVNSLNVAFHSRYMQPIGPALQEALEKVVPEARPRT
ERWISSSVPQSRWGEPLAQKCSAVYHVNNLLSPVLFREALEHVPKNAIVVEIAPHCLLQA
ILRRALGPEATCLGLMKRDVPDVPAFFLTSLGKLHAHGVPLQLEPLFPRVPWPVPRGTPN
VAHLVSWDHSQSWSVVTYNDFSTSAQVSVSEEVAEFDLEAGENDAYLAGHQIDGRVLFPA
TGYMVLAWKSLAKRSGKPYNQVPVVFEDVTLHRATILPKSGPVRFMVNVMRVSGEFEVCE
AGAVAASGRVYLAEVGQKLLDHEAPSEPPETVTFDLDAEDIYKELRLRGYEYSGSFQGIL
KADIQHPYGKLKWEDNWVTFMDTMLQFSILGNPMRSLNLPVRIHSCRVDPAVHARAVSTA
GDKGVDVVYEKYLNVCRAGGVVMKGLKANVAPRRGVQQEPFLEEYQFVPYLDDESAGRQR
EAAVREYVEVCCGVARRVLESCGKNKAQISDVMNGFREAPEQVLHKYLESPAENHGLLRV
LASVQNESKSSAGSLVATVQSALAAHKEDLERDLLNTALLEEDPLRHLLDVVVENTSVKK
LKVLEMAADAGPSLLAPRVSAILALSHILLKTDLTIAHPQPDVFTEEQVPEGAKKVAWDV
ASPSKTALPEADLLVARDAVGSKALEALTDALAAQSREGGFVLLSLRTALTPAEMFLSTV
GKVPLRVHSRDSVEAAFRERGFRLVGLRSNNVSALLLFRKRPATPAGVDKQAVIRVGNGG
LGWVEEIKAKATEYQERPVGENVWLVAEDVGTSGVVGLTNCLRQETGGDHIRCVFNASLK
GGVNPVANFQPASSEHKELVERDLVMNVYRDGKWGSFRHTVTQSRGAPRLWTEQAFLNVQ
TRGDLSSLQWYESPLRYRPASDDRVLCSVYYAPLNFRDIMLATGKLPPDALPGNLATSDC
VLGLEFSGRDPSGRRVMGSVAAEGMATVVAADPGFLWEVPANWSLEEAATVPVAYSTAYY
ALLVRGAMHPGEALLVHSGSGGVGQAAISIALSMGCTVFTTVGSQEKREFLKRRFPQLQD
RNFANSRDLSFEEHILRETEGRGVDLVLNSLAEEKLQASVRCLATHGRFLEIGKFDLSQN
NALGMAVFLKNVSFHGILLDALFGDDPRVAADKRRVAQLVREGIASGAVRPLDAVRFARD
HVEDAFRFMASGKHMGKVVLEVRPEEPQRQTVPATPLSVEAHTRTCFFEDKSYVVAGGLG
GFGLELADWMVARGCRKLLLTARSGVRTGYQRLCLHRWRLAGAKVAVSRADAATEEGARA
LLREAAALGPVGGIFNLAMVLRDALLENQTAEAFEAVCRPKVAGTLHLDAASRELCPQLD
HFVTFSSVSCGRGNGGQTNYGYANSVMERVCERRVADGLPGLAIQWGAIGDVGVLRETMG
ADVVVGGTVPQRIGSCLTVLDRFLRQGHPVVSSLVKAELSSGKKGKDKQDLVLSVAHILG
VKDPSSLNPSLTLGELGMDSLMGVEVKQTIERDYDLNLSMQEIRQLSIGRLKEIGGGAAA
GGSAAPQGAGAPGALPKTLVAGHVGALSELAQQLPVRAVGLQRTRDIPAHSIEELAAIYL
QRLVEVQPQGPYHIVGYSFGATVAFELAVQLQGAGAPVGSLVLLDGAPQYIGVHTVHHRS
RFTDANEEEASLFCAFLMQYLDIDFLQVKRQMVQYPTWEAKQEAATDLLLAGIPDVHPSR
EDVALATSAFYDFLKCGSEYTPTAKFRGDVTLVKASRPRKMAMQLPPDYGLSE
NT seq 7362 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgaagacgtggtgatcacgggcttctcggcctactttccccaggccaaccat
ctggccgagtttcggaagaagctctacgatggcgtcgacatggtcaccgacgacgaggcc
cgctggcccagagggctgctgggccttcccgaaaggtccggcaagatccgggacctgtcc
cagtttgacgcgcagttcttcggcgtgcacccgaagcaggcgcacgtgatggacccgcag
ctgcgcctgttcctcgagacgtcgtacgaggcgatcgtggacgccggctacgacccgggc
acgctgcggggacgcaagatcggcgtcttcatgggcagcagcgagtccgagaccgacgag
gccttcaacgtggacacagacaagatcgacggctacgccctggtcggctgctgccgggcc
atgttctccaaccgcgtctcttactccctagacttcaacgggccgagcttcaccgtggac
acggcctgttcgtcggccatgacggcgctgaaccaggccatgctggcgctgcgctcggga
cagtgcgaggcggccctggtcgggggcagcacgctcaccctcaagcccaccacggcactc
aacttctaccgcctcggcatgctgtcgccggacggcatgtgcaaggccttcgacgccaac
ggcaagggctacgtgaggagcgagaccgtgggcgtgttcttcctccagcgggtctcggag
gcacggcgcatctacgccaagctggtgcacgtcaaggccaacgccgacggtttcaaggcc
gaaggcatcacgtttccctcgggccgtgcccaggaggcgctcctgagggacgtgtacgaa
gaggccggggtggacccccgctcggtgtcgtacgtcgaggcacacggcacgggcaccaag
gtgggcgacccccaggagatgagcgccatcagcaacgtcttctgcggcgagggacgcaag
gagccgctcctcatcggctccgtcaagtccaacatgggccactccgagggcgcctctggc
atctgctcgtttgccaaggtgatcctgtccatggagaccggcaccatcccgggcaacctg
cacttcaacgagccaaacccgggcatcccgtccctgaacgacggcagcattcgggtggtg
gatcgccacatgccctttccggggggcctggttggggtcaactccttcggctttgggggc
gccaacgtgcacaccatcctggaggcaaacccgggcccccacgtggactccttcccccgg
gagaagccccagctgccccggctggtgctgctcgcaggcaggacccaggagtcgctcacg
gccaccctggaccggctggaggcggatggacccctaccggacccagcctacgccctgctc
aaccgggtcgggcagcccaacatgacccagttcccgttccgcggctactccgtggtggct
gtggatggctcccgcgaacccatcaagggggtcgaggtaggtcccagccttcctttggtc
tcactggcccaggcaccacagcccctgcagtattgcatcgagggcggtattcttcaacac
actcgacgtgtttgccgactcatccgccgctccacgagctcttgtgcccttcgcatcgac
ctcatagacctgatcacaagcgacaacgccaacaacagacgatgtcttcttgggcatggt
tggcaggacgggggacgttgcgctttcccgcaggtggcgctggtgtccatgctgaaggca
gtgggggtggagccggacggcatcgtgggtcactcagtgggagagattggctgtgccttt
gccgacgggggtttcacggccgagcagacggtgctgtgcgcctactggagggggcgctgc
gtcgagctgggcaacctgcccaagggggccatggctgccgtcggcctgacctgggagcag
gcgaagcagcgttgccgcaacggagtgatcccggcctgccacaacgcggaggactccgtg
actgtgtccggtccggccgaggcggtggcggagctggtggcacagctcaaggcggagaac
gtgtttgcccgggaggtgaacagtctgaacgtggccttccacagccgctacatgcagccc
attgggccggccctgcaggaggccctcgagaaggtggtgcccgaagcccgcccccgtacg
gagcgctggatcagctcgtcagtgccgcagagccgctggggggagccactggcccagaag
tgctcggcggtctaccacgtgaacaacctgctctcgcccgtcctcttccgagaggccctg
gagcacgtgccgaaaaatgccattgtggtcgagattgcgccacactgcctgctgcaggcc
atcctgcgacgggccctgggaccggaggcgacctgcctggggctgatgaagcgggacgtg
ccggatgtgccggcctttttcctgacctcgctgggcaagctgcacgcccacggggtgcca
ctgcagttggagcccctgttcccacgggtgccgtggcccgtgcccaggggtacgcccaac
gtggcccacctggtcagctgggaccactcgcagtcctggtccgtggtcacctacaacgac
ttctccacctcggcacaggtgagcgtttctgaggaagtggcggagtttgacctggaggcc
ggggagaacgacgcctacttggcggggcaccaaatcgacgggcgggtgctgttcccggcc
acggggtacatggtgctggcctggaagtccctggcgaaacggtcgggcaagccttacaac
caggtgcccgtcgtcttcgaggacgtcaccctgcacagggccaccatccttcccaagagc
ggcccggtgcgcttcatggtgaacgtgatgcgcgtgtcgggcgagttcgaggtgtgcgag
gccggcgcggtggccgcgagtggccgcgtctacttggccgaggtcgggcagaagctcctg
gaccacgaggcgccctccgagcccccggagacggtgacctttgacctcgacgccgaagac
atctacaaggagctgcgcctccggggctacgagtactccggaagcttccagggcatcttg
aaggccgacatccagcacccctacggcaaactcaagtgggaggacaactgggtgaccttc
atggacaccatgctgcagttcagcattctcggcaaccccatgcgctctctcaacctgccc
gtcaggatccactcgtgcagggtggacccagcagtccacgccagggctgtcagcacagcg
ggagacaaaggagtggacgtggtctacgagaagtacctcaacgtctgccgcgccggcggc
gtggtcatgaagggcctcaaggccaatgtggcgccccgccgaggcgtgcagcaggagccg
ttcctcgaggagtaccagttcgtgccctacctggacgacgagtcagctggccgccagcgc
gaggctgcggtccgcgagtatgtcgaggtctgctgcggcgtcgcccgccgcgtgctcgag
tcatgtggcaagaacaaggctcagatctcggacgtgatgaatgggttccgcgaggcgccc
gagcaggtcctccacaagtacctggagagcccggccgagaaccatggcctgttgcgcgtc
ctggccagcgtccagaacgagtccaagagctcggcgggctccctggtggccacggtccag
tcggccctggcggcccacaaggaggacctcgagagggacctcctcaacacggccctcctg
gaggaggacccgctgcggcacctcctggatgtggtcgtcgagaacaccagtgtcaagaag
ctgaaagtcctcgagatggccgcggatgcgggcccctcgctcctggcgccccgggtatcc
gccatccttgcactgtcccacatcctcctcaagacggacctgacgatcgcacatccgcaa
ccggatgtctttacggaagagcaagttccggaaggcgccaagaaggttgcctgggacgtg
gcgtctccgtcgaagaccgcccttcccgaggccgacctcctggtagcccgtgacgcagtc
ggcagcaaggcgctggaggcactcacggatgcgctcgcggctcagtcgagggagggcggc
tttgttctgctgtccctgcggactgcactcacgcccgccgagatgttcctgtcaactgtg
ggcaaggttccactccgggtacactctcgagactctgtcgaggctgccttcagggagcgt
ggcttccggctcgtgggcctccgatccaacaatgtgtccgcgctcctgctgttcaggaag
aggccggccacgccggctggtgtagacaaacaggcagtgatccgggttggaaacggcggg
ctcggctgggtggaagagatcaaagccaaggcaactgagtaccaggagaggccggtgggc
gagaatgtctggctggtggctgaggacgtgggcaccagcggggtcgtcgggctcaccaac
tgcctcaggcaggagactggaggggaccacatcaggtgcgtcttcaatgccagcctcaaa
ggcggcgtaaacccagtggccaacttccagccggccagctcggagcacaaggagcttgtg
gaacgtgacctggtcatgaacgtctaccgcgatggaaagtggggctccttcaggcacacc
gtgacgcagtcacgcggcgccccccggctgtggacggagcaggcgttcctcaacgtgcag
acccggggtgacctgtcgagcctgcagtggtacgagagccccctgcggtaccggccggcc
tcggacgaccgggtcctgtgcagcgtctactacgcgcccctcaacttccgcgacatcatg
ctggccacgggcaagctgcccccggatgccctccccggcaacctggcgacatctgactgc
gtgctggggctggagttctccgggcgggacccctcggggcgccgggtgatgggctcggtg
gcggcggagggcatggcgaccgtcgtggcggccgacccgggcttcctgtgggaggtgccg
gcaaactggagcttggaggaggcggcgacggtgcccgtggcctactcgacggcctactac
gccctgctggtgcggggcgccatgcatcccggggaggccctgctggtgcactcgggcagc
gggggcgtcggccaggctgccatctccatcgccctctccatgggctgcacagtcttcacc
accgtcggttcccaggaaaaacgggagttcctgaagcggcgcttcccacaactccaggat
cgcaacttcgcaaactctcgagacctgtccttcgaagagcacatcctccgcgagacagag
ggcaggggggtggacctggtgctgaactcgctggccgaggagaagctgcaggccagcgtg
cgctgcctggccacccacggccgcttcctggagatcggcaagttcgacctgtcccagaac
aatgccctgggcatggcggtgttcctcaagaacgtcagcttccacggcatcctgctggac
gccctgtttggggacgacccacgggtggcagcggacaagcgccgggtggcccagctggtg
cgcgagggcatcgcgtcgggcgcggtgcgtcccctggatgctgtccgctttgcccgggac
cacgtcgaagatgccttccgcttcatggcctccggcaaacacatgggcaaggtggtgctc
gaggtgcggccagaggagccccagcggcagacggtaccggccacgcccctctcggtggag
gcccacacacgcacctgcttcttcgaggacaagagctacgtggtggccggaggcctgggg
ggcttcggcctggagctggcagactggatggtggcccggggctgccgcaagctgctgctc
acggcccgctcgggtgtccggacgggctaccagcgcctctgcctgcaccgctggcggctg
gccggcgccaaggtggcagtgagccgggcagacgcagccaccgaggagggcgccagggca
ctgctgcgggaggccgccgcccttggtcccgtgggcggcatcttcaacctcgccatggtg
ctgagggacgctctgctggagaaccagacggcggaggcgttcgaggcggtgtgccgcccc
aaggtggccggtaccttacacctggatgcggcgtcccgggagctgtgtccccagctggac
cacttcgtgactttctcgtcggtgtcgtgcggccggggcaacgggggccagaccaactac
ggctacgcaaactccgtcatggagcgcgtctgcgagaggagggtggccgacggactgccc
ggcctggccatccagtggggcgccatcggcgacgtgggcgtcctgcgagagacgatgggg
gcagacgtggtggtgggcggcacggtgccccagcgcatcggctcgtgcctgacggtgctg
gaccgcttcctgcgccagggccaccccgtggtctcgagcctggtcaaggccgagctctcc
tccgggaaaaagggcaaggacaagcaggaccttgtcctgtctgtggcacacatcctcggt
gtgaaagacccctcgagcctgaacccctccctgaccctgggggaactgggcatggactcc
ctgatgggcgtcgaggtgaaacagaccatcgagagggactacgacctcaacctgtccatg
caggaaattcgacagctcagcatcggccggctcaaggagattggcggaggggccgcggcc
ggaggttctgctgcaccccagggggcaggagcgccgggggcactgcccaaaaccttagtc
gcgggccacgtgggggccctctccgagctggcccagcagctgcccgtgcgggccgtcggg
ctgcagcgcacacgcgacatccccgcacacagcatagaggagctggccgccatctacctc
cagcggctagtggaggtgcagccccaggggccataccacattgtgggctactcgttcggg
gccacagtagcctttgagctggcggtgcagctgcagggggcgggggcccccgtgggcagc
ctggtgctcctcgacggggcgccccagtacatcggcgtgcacacggtgcaccaccgcagc
cgcttcaccgacgccaacgaggaggaggcctccctcttctgcgccttcctcatgcagtac
ctcgacatcgacttcctccaggtgaagcggcagatggtgcagtacccgacgtgggaagcg
aagcaggaggcagccacggacctgctgctggcgggcatccccgacgtgcaccccagccgg
gaggacgtggccctggccacgagcgccttctacgacttcctcaagtgcggcagcgaatac
acccccacggccaagttccggggggacgtgaccctggtcaaggcttccagaccccgcaag
atggccatgcagctgccccccgactacggcctctccgagtag

DBGET integrated database retrieval system