KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW009293Help
Entry
IscW_ISCW009293   CDS       T01131                                 

Definition
hypothetical protein
Orthology
K11422  
histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:isc00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    IscW_ISCW009293
Enzymes [BR:isc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     IscW_ISCW009293
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 1084 aa AA seqDB search
MNGVRPVHHDASHGEKKKRNYKLLVDPAMKKGAVKVYRYDGVVPGQENLYPPVQVRDPRS
RLAFLWARTEIADLPVPKFKIDEHYVGIPPPLEVTLTNLNDNIGKGFLDDLVKKFGQVDE
SVVYYHGRTRKHLGLARVVFSTTQAARFCVDKMHLSSVMGNILNVFFDPFGRECQRLYEE
LCSERPKFPEPLAFAPEPPPPPLPQPPLPPIGAPSTQLPPRALPPSGSSASTPCSSTAAP
QQSDYSGYSNHSDYGSASAASYRSNASTPLSYDSGYSYCASSQYAAATGHHPASAWDVNH
AGSWPPTADGMHQWRGAAQWDPHAASDAIPQKLSPARESLDSRIELLLKQTEGRGSFLDV
AGGVPVFGSPPFDGTPQQQESPVSKAAPPLPEGASFSDHVPHVSPTAASYAYASSTAAGA
PPPPPPPPPMLHSYNPNYPPPPLHQYGSSGSTHPVHLSPARAPHHYPPPSPYYPPGTSTP
PSHYGAVREYGRVPPPSPYRWYGSADPNAATVRAVLGALVAELREIVKRDICKRMVENYA
FKRFEAWWDEQVSAASKVRTSKTSEVAPQEATSSQPAVSSLSSLFDGSRESGFSIGEGFG
SGFGFGLRAAMPRMPSFRRIRKPPSPPPLDDEDSKKPDDSDGEHDKLSDSESESPRQRRG
SVPVVEEEHSTQESDSDKADSDSESESDESSESESSSEEDGDEEASSSESGESESDSESE
EDEAEVVASGKEESRDKPVTRSPDARRELFVSDIEDSKKEPEPEIIKRDNEAEVRTAESP
AASPTPTKEDIKSEEVDVDVDVTPSPTPSPHEDDAETQQPEPELPAARFVAAGVPDVRPT
AEPPKVEPAPTEPPQSRDLEYEASEALMALAAGFAEPELPTPAKNEFLVNGDVTGALATK
VGEDVKDEEDVPNYLRSDHCYCLPRQNAADGDGAPLDLVTTGDHEYTRMATTPPPPPVEV
LESLVHPAASPPKTPTGRKNSRKGKERQSAKERLLLEEPLLLEPVTKLSRAVAFAKRNVV
EEMNILYEFLRTGVDAEDVQYLKRSYDAMLQDEIQGYWLNDTHWVDHPHILSLRPLSFMC
FVSF
NT seq 3255 nt NT seq  +upstreamnt  +downstreamnt
atgaatggcgttcgacccgttcatcacgacgccagccatggggagaagaagaaaaggaat
tacaagctgctggtggacccagcgatgaaaaaaggagccgtcaaggtctacagatacgat
ggagtcgttccagggcaagaaaatctttaccctcccgtccaagtccgtgatcccaggtcc
cgccttgcatttctctgggcacggactgaaattgccgacctgcctgtgcccaagttcaag
atcgacgagcactatgtggggatcccgcccccgctggaggtgacactgaccaacctcaac
gacaacattggcaagggcttcctggacgacctggtgaagaagtttggccaggtggacgag
tcggtggtgtactaccacggccgcacccgcaagcacctgggcctggcacgggtggtcttc
tccaccacccaggcggcccgcttctgcgtcgacaagatgcatctctcctccgtcatgggc
aacatcctcaacgtcttcttcgatcctttcggtcgggagtgccagcggctgtacgaagag
ctctgctccgagcggcccaagttcccggagcccctggcattcgcacccgagccccctccg
cctcccctcccccagccccccctgccccccatcggcgctccctccacgcaactgcccccc
agggcgctgcccccctccggttcctctgcctccacgccgtgctcctcgaccgccgcaccc
cagcagtcggactactcgggttactccaaccactcggactacgggtcggcctccgccgcg
tcctaccgctccaacgcgtcgaccccgctcagctacgacagcggctactcatactgcgcg
tcgtcccagtacgccgcggcaacggggcaccaccctgcgtcagcttgggacgtgaaccac
gcgggctcgtggcctccgacggccgacgggatgcaccagtggcggggtgcggcgcaatgg
gacccgcacgcggcgagcgacgcaatcccccagaagctgagccccgcgcgggagagcctg
gacagccgcatcgagctcctgctcaagcagacggaaggtagggggagcttcttggacgtg
gccggaggcgtcccggtgtttgggagcccccccttcgacggcacaccgcagcagcaggag
tcgcccgtctccaaggcggcgccgccactgcccgaaggggcatcgttctccgaccacgtc
ccgcacgtgtctccgacggcggcctcgtacgcatacgcgagttccacggcggccggcgca
ccacctccgccccctcctccccctccgatgctccactcgtacaaccccaactaccctccc
cctccgctgcaccagtacggctcgtcggggagcacgcaccctgtgcacctctccccggcc
cgcgccccccaccactacccgccgccgtccccgtactaccctccgggcaccagcacacct
ccgtcccactacggagcggtgcgcgagtacggcagggtgccgccgccctcgccgtaccgg
tggtacgggtctgccgaccccaacgcggccacagtgcgtgcggtgttgggcgccctggtg
gcggagctgcgggagattgtcaagcgggacatctgcaagcgcatggtggagaactacgcc
ttcaagcgcttcgaggcctggtgggacgagcaggtgtcggcggcctccaaggtgaggacc
tccaagacatcagaggtggctccccaggaagccacgagcagccagcctgccgtctcttca
ctgtcgtcactcttcgatggctctcgggaatccggcttctccattggcgagggttttggc
tccggctttggatttggactgcgtgcagcgatgcccaggatgccatccttcaggagaata
cgaaaaccgccttccccacctcccctcgacgatgaggacagcaaaaagccggatgactct
gacggcgagcacgacaagctctcggattccgaatccgagtcgccgcggcagaggagaggg
agcgtccccgtcgtggaggaggagcacagcacccaggagagcgacagcgacaaggcagac
tcggattccgagtcggagtcggacgagagttcagagtctgaaagcagttcggaagaagat
ggggacgaagaagcctcgtcatcagaatctggtgaatcagagtccgattctgaatcggag
gaagatgaagccgaggtcgtggccagtggtaaggaagaaagtcgagacaagccggtcaca
aggagccccgatgctcggcgggaactttttgtgtccgacattgaagacagcaagaaggag
ccggagccagaaatcattaagcgagacaacgaggcagaagtccgcacggctgagagcccc
gcggcatctccaaccccaaccaaagaggacatcaagtccgaagaagtggatgtcgacgtt
gatgtcaccccgtctccgacgccatcgcctcatgaagacgacgccgagacgcagcagccg
gaacccgaattgcccgcggcgaggttcgtcgcggcgggagtcccagacgtccgcccaacc
gcggagcctcccaaggtggaacccgcgcccactgagcctccccaatcccgcgacctcgag
tatgaagcgtcggaagcgctcatggccctcgcggccgggttcgcggagccggaacttccg
actccggcgaaaaacgagttcctcgttaatggggacgtcacgggcgccctcgcgacgaag
gtcggagaagacgtgaaggatgaggaggatgttccaaactacctcaggtcagaccactgc
tactgcctgccgaggcaaaatgccgcggacggcgacggagcgccgttggacctcgtgacg
acgggcgaccacgagtacacgcggatggccaccacgccacctcctcctcccgtggaagtg
ctcgagagtctagttcatccggcagcgtcaccgcccaagactccgacggggcgcaagaac
tcgcggaagggtaaagaacgccagtcggcgaaggagcggctcctgctggaggagcccctt
ttgctggagcccgtgaccaagctgtcgcgggctgtggcgtttgccaagcggaacgtcgtc
gaggaaatgaatatcctgtacgagttcctgaggacgggggtggatgcggaggatgtgcag
tacctcaagcggagctacgacgccatgctgcaggatgagatccagggatactggctcaac
gacacccactgggtggaccatccgcatatcctttcactgcgccccctttcgttcatgtgt
tttgtctcgttttga

DBGET integrated database retrieval system