KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW009303Help
Entry
IscW_ISCW009303   CDS       T01131                                 

Definition
prostate-specific transglutaminase, putative (EC:2.3.2.13)
Orthology
K05619  
transglutaminase 1 [EC:2.3.2.13]
Organism
isc  Ixodes scapularis (black-legged tick)
Brite
Enzymes [BR:isc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     IscW_ISCW009303
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 219 aa AA seqDB search
MRSPAQTPVGRWTLGLKTGDEDVHVVDRHIYIIFNAWLPEDPVYMENEEEREFYIVKDSS
VYFYGTHKNWAKKKWYYGQFEKVTLAAIEFLLRRSGLTSAQRADHVMLVRALAAAVNMQD
DQGVMLGRWTTPFSGGTSPSAWNSTLPILNKYMESGGNAVKYAQCFVFGAVLTTLLRALG
IPSRTVTNFGSAHDDDGDMAVDYYYDENEKHIPGGDQEW
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgcgttccccggcacaaacgccggtaggacgctggactctgggtctgaagacaggagac
gaagacgttcacgttgtcgacagacatatctacatcatcttcaacgcatggctccctgaa
gatcccgtatacatggaaaacgaggaagaacgcgagttttacattgtcaaggactcaagc
gtctatttctacggaactcacaagaactgggccaagaagaagtggtactacggacagttt
gagaaagtgaccctcgcagctatcgagttcctcctgaggagatcgggactgacttcggct
cagagagcggaccacgtaatgctggttcgggccttggctgcagcggtgaacatgcaagac
gaccagggtgtgatgcttggccgctggacgacgcctttttccgggggaaccagtccctct
gcctggaactccactctgccgatcctcaataagtacatggagtccggcgggaacgccgta
aagtacgcccagtgctttgtctttggggccgtcctcactaccttgcttcgggcgctggga
attccaagtcggactgtcaccaacttcggttctgcccacgacgatgacggggacatggca
gttgactactactacgacgaaaatgaaaagcacatcccaggcggggatcaggaatggtaa

DBGET integrated database retrieval system