KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW009315Help
Entry
IscW_ISCW009315   CDS       T01131                                 

Definition
phospholipase C epsilon, putative
Orthology
K05860  
phosphatidylinositol phospholipase C, epsilon [EC:3.1.4.11]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:isc00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    IscW_ISCW009315
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    IscW_ISCW009315
Enzymes [BR:isc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     IscW_ISCW009315
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 651 aa AA seqDB search
VSSWVTHIIISQPTHDDRKAVLSCILRIAMSCWNIGNFNAAMEILAGLKSEKLKPFWLSL
SDKDQLPVLDFLSQALLNPEPSKEYREAVQRALNIPHSKVVPFFGTFLRELRAILQGMPS
LIVLPSEGARSIEFVADYHGEDHFMTRIGVGGIINVEKMDEAHRVLDEIKAFHHHHKCRK
HATAQVAINSQEARRDGCGSSRAEDESLYMQDLAAYIPIQGLKHNHDVSLIPLQVDTVDF
HELQILHHGCTIVHWEEDGSRSVLCYARLESHNGTITWCRPTWSALQVSGPRDYSLSANI
EECVPIGVVQKCETGESYQAGLEEGFVDLHIVKEIVLCRSSIEVAAVARRHGLEDSICDQ
NLLRIKFGTGLSENRVLEFILPGTLAEVWYKSIRRLVAMLKQQRQLCDSRIYWLKETFLQ
LYYNEQNCSGPTAFEDRPCHESRDPITTSALLNRLVITSGSRLTFSSFVELFRSFMVHAR
RDIFALFCAMATDDNAIFVFDIDEGPPRKPSPTVKKRRATVKSSPQMRSQESSPQRLSVS
RSSSSCENLNRVDGGVPVVQPIPQTAGDDDGYKQRKSSSQIAPELSDLVVYCQAIKFRDA
GLHVNAAMFEQNGSCGYVLKPRVMWDRSHMMYGRFNPWDKDFDRCMPSDFK
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
gtgagctcgtgggtcacgcatatcatcatctctcaaccaacgcacgacgaccgcaaagcc
gtcctgtcctgcattctccggatagccatgtcctgttggaacattgggaacttcaacgca
gcgatggaaatcctcgcaggactaaagtctgagaagctcaagccgttctggctttccctt
tcggacaaggaccagctgcccgttttggattttttgagtcaggccctgctgaatcctgag
ccctccaaggaataccgggaagccgtgcagcgggcgctcaacattccgcactccaaggtg
gtgcctttcttcggaaccttcctccgagaactgcgggccatcctccaaggcatgcccagc
ctcattgtcctgccctcggaaggggccaggagcatcgagttcgtggccgattatcacgga
gaagaccattttatgacgcggattggagtagggggcatcatcaatgttgagaagatggac
gaagctcaccgcgtcctggacgagatcaaagccttccatcatcatcacaaatgcagaaag
cacgccacggcacaagtggctatcaacagccaagaagccaggcgggacggttgcggcagc
agtcgcgcggaggacgagagcctgtacatgcaggacctggcggcctacatcccaatccag
gggctcaagcacaaccacgacgtcagcctgataccactccaggtggacactgtagacttc
cacgaactgcagatcctccatcacggttgcaccatcgtccactgggaagaggacggctcc
cgctcggtgctgtgctacgcacgccttgaaagtcacaacggaacgataacttggtgcaga
ccgacgtggagtgccctacaggtatccggcccgcgggactactctctcagcgccaatatc
gaggagtgtgtgcccatcggcgtcgtccagaagtgcgagaccggcgaatcgtaccaggcg
ggcctggaagaaggttttgtcgacttgcacatcgtcaaagaaattgttttgtgccggagc
tcgatcgaagtggctgctgtcgccaggcggcacggcctggaagactcaatctgcgaccaa
aacctcctgagaatcaaattcggcacagggctctctgaaaacagggttcttgagttcatt
ctgccggggactctcgccgaagtgtggtacaagagtatacggcgccttgtcgccatgctc
aagcagcagcggcagctgtgcgacagtcgtatttattggctcaaggaaactttcctccag
ctctactacaacgagcagaactgcagtggacccacagcttttgaggaccggccgtgtcac
gaatcccgggacccgatcaccacctccgctcttctgaaccgtctagtcatcaccagcggc
agccgcctcaccttttcttcgttcgtggaactcttccggtcgttcatggtccacgcccga
cgcgacatcttcgctctgttctgcgccatggccaccgacgacaatgccatctttgtgttc
gacatagacgaaggccctccccgcaaacccagccccactgtgaagaaacgccgagccacg
gtgaagtcctcaccccagatgcgctcccaggagtcgagccctcaacgactcagcgtctca
cgcagttcctcttcctgcgaaaacctgaaccgcgtcgacggcggagtccctgtcgtccag
ccgattccgcagaccgctggcgacgacgacggctacaagcaacgcaagtccagctcacaa
attgcgccagaattgtcggacctcgtggtctactgccaggccatcaagtttcgagatgcg
ggcctccacgtcaacgcggcgatgttcgagcagaacggaagctgcggctacgtactgaag
cccagagtgatgtgggatcgtagccacatgatgtatggccgcttcaatccgtgggacaag
gatttcgatcgctgcatgccctcagacttcaaataa

DBGET integrated database retrieval system