KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW009446Help
Entry
IscW_ISCW009446   CDS       T01131                                 

Definition
nuclear pore complex protein Nup205, putative
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:isc00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    IscW_ISCW009446
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 1986 aa AA seqDB search
MAAQSVAVNLAGSSVWAPFKDLNFAVEAVLLNKDVEAVPDFVAALRRHKPDFASLLQNPA
RSAQHRDAVAKASKEGIRVVGQTAPQVLPQSIVDEALIISDMLELNELVSLELLLAGQQQ
QPLFPELTRGLVAVLLYYDGRRALVNSLRTLVQVTEGRTWTLGLNTDVVATVTKYTDGLK
DEDGVFMKVMDLLEKLDLARELDMLQRSKALGGPRYRKQVTDMIQETHQSLAEIVFCWSC
QTVLSKEEALRLLKFVASSADTAGDGSLHGVTLTVLMALLYVMDVSVLQTCEDSSKEIDK
LPLVQNPDVAVALHRHLSSDAAWKIEGLRAVVCFAWALTLRTFSQFPLVSVEPELAACLE
DDERTMDAALEGRAFPSLLHLVVRSPLLHREEFFLKRMHGLLVDFIVLMPLRVKELRNQG
DETARIVSAYLNDGLAPPSTLTRHFEHLLELIAEVYAKDPLELRLSEQYWCPGDVSDHSY
APKPSQRQVALFKFLRFSGDLLPPSLFTPYVSVLTSLAQSRTGAHHCFNLLKNNGRYSTG
PQESLVSWDHFFGSLRSYYNSLRQEGPLSVESHLYRPPFPRGISSVEVKALIAVLQLVET
VVHWDEVARITLAENPHHVPLALLVHLVGCGVAPELKAAFLGTLSAFATSPEVALKIWQC
LEGAQILPVRQGGLAPNPPPGIQTELEEVEARNEEFPITRALLKLVSALVDHPLPSSAHG
AALLRSGLDPYMDFVRDAVFLKFHIRAYKQEEEKWEVARLCLEIIEKLLRKHGVGPGIDA
AKLLASDTPPLGTQVAFNLLAHLLQDGTFLRLILFVLDEGARQLETYLPFPGQKQLEEAA
LLSLRILHLALLQQEPFLHQVRNSNAALIVSSMNQLLMAANPRTGRPDYGLVISQYVTYN
TFLPWHTLVASRILLLLCGQSKMAEHLATAFTFEKMQGLRLIHGFAESLDVDLGPDPPAG
NERDWTLREVRTASSHTLLKMLLSCLEHPVLNVGHYLLGFDIKRSIAKTTLQEPGVLGSA
RTCLHAILSFLDNSSEARVPGGPPSVVELGYKLVYVLCANPATTEPTMRYLRSTRDFFYK
HLQKQPKRYLKSHGDTDVKLLMQQSWFLRAVALELRVTASQNQRSHIQRLVTLLLEDNPQ
LLTCPIDGAAELSSFLSSSASMRPSAFAGTLRRKLLKLLDAVDTMKHTVPSAPTWEYLDS
VELERALAECEYQEPGGPIMIDVGAVHQRLLEASAKLQGFVALGQKSMVVQEVKAVLQYT
LAKNRCCQGSFAKRHYFLAWQQLVEVVVTVCPQDIFGGDLKIQVLLEVAQELLRRLLDGN
SLTDLLAPSSGVLLVLMAALHHCLLTMGHLLRMSGRRADHSNVLTHLMPNRSTAQDTALQ
VSLTTYSSSILAVLKSLLECLIQTGSGFQRVRANYYGSLLNLLRVVHRSPETQGAPGGGV
DRVFEDSSSDGERLRKSHAEALFSYGEQLMEVVCRDVCGSHEITQMLSLAALDAVVSLDT
HGHWLSYLCRKGYLHHLTDGVSSADADIRTVLVKGSSKGSSLRSLYVLESKLSLLTRLAA
SPAGAQALLESGLVGKLAECEALDLYPSIAGGLPDLASRWPCPPATKCYQQLFVPVAQLL
LSIAASLGPGHKEAGFQVRNFLGAHAQVFSAMLQPRNLENSDLTALEEAALASALVAVLA
DGAEDDDDVALLEHQGHLRMLQNQMLSLLSWLVPEADAASQLPHERILRLRISCSVFRFC
SSLCRLAGAKDRKWFRILFAPTASVEAPPRSGRSGVSGVIAAPPPGLGLLVRALLAYSAE
AQRTAVARDCLARKLAALDDLGSAELAELLLAADQDQPSSLQPGKLREAARRQIGREAAL
AKKELSLLTVAVEQALFLLWRHLEYFLVQCVPSGRAKRGLVRPAEGQFGTPMREGTLGRV
PASEAVTVEDVEALKADVKATLNDAFFRGVQVRESYLREESASSSNPRFFEALLRRLKRL
ATLQAH
NT seq 5961 nt NT seq  +upstreamnt  +downstreamnt
atggccgcccaaagcgtggcggttaatttggcaggctcgtcagtttgggccccgttcaaa
gacttgaacttcgccgttgaagccgtgcttctcaacaaggatgtggaagccgttccagac
ttcgtggccgctctcaggcgccacaaacccgatttcgcgtccctgctgcagaatcctgcc
aggagcgcccagcaccgggatgctgtcgccaaggcgtccaaggaagggatccgcgtcgtg
ggtcagacggcgccgcaggtgctgccacagagcatcgtggatgaagcgctcatcatcagc
gacatgctggagctgaacgagctggtgtcgctcgaactgctgctggcgggccagcagcag
cagccgctgttcccggagctgacgcgggggctggtggcggtcctgctgtactacgacggg
cgccgggcactagtcaactcgctgcggacgctggtccaggtgaccgagggccgcacctgg
acgctgggcctcaacaccgacgtcgtggccaccgtgaccaagtacacggatggcctgaag
gacgaggacggcgtcttcatgaaggtgatggacctgctcgagaagctagacctcgccagg
gagctggacatgctgcagcggagcaaggcgctcggcggaccgcgctaccgcaagcaggtc
accgacatgatccaggagacgcaccagtcgctcgccgagatcgtcttctgctggagctgc
cagacggtgctgtccaaggaggaggcgctgcgtctgctcaagttcgtcgcgtcgtcggcc
gacaccgcgggcgacgggtccctgcacggcgtgacgctcacagtgctcatggcgctcctg
tacgtgatggacgtaagcgtgctgcagacatgcgaggacagttctaaggagatcgacaag
ctgccactggtgcagaacccagacgtagccgtggcgctgcaccgccacctgtcgtccgac
gccgcctggaagatcgagggcctgcgcgccgtcgtctgcttcgcctgggccctgacgctg
cgcactttctcgcagttcccgctggtgagcgtcgagcccgagctggcggcctgcctggag
gacgatgagaggaccatggacgctgccctagagggccgggccttccccagcctgctccac
ctggtggtgcgctccccgttgctccaccgggaggagttcttcctcaagcgcatgcacggc
ctcctcgtcgactttatcgtcctaatgcccctccgggtgaaggagctgcgcaaccagggg
gacgagacggcccgcatcgtgagcgcctacttgaacgacgggctcgcgcccccgtccacc
ctgaccagacacttcgagcacctgctggagctgattgcagaggtctatgcaaaagaccca
cttgagctgcgcctctcagaacagtactggtgccccggcgacgtctcggaccacagctac
gcacccaagccgtctcagcgtcaggtggcactcttcaagttcttgcgcttttctggcgat
ttgttgcccccttccttgttcacgccgtacgtctctgtactcactagccttgcacagtca
aggaccggtgcccaccactgcttcaacctgctaaagaacaacggtcgctacagtactgga
ccccaggaaagcctagtctcctgggatcacttcttcgggtcgctccggtcgtactacaac
agtcttcggcaagaaggtcccctcagtgtcgagtcccacctatacaggccaccatttcca
cggggaatatctagcgtcgaggtgaaggcactcatagcggtcctgcagctagtggagacg
gtcgttcattgggacgaagtggctcgcatcacgcttgcggagaacccgcaccatgttccg
ctggcgctgctcgtccacctggttgggtgcggggtggcccccgagctgaaggcagccttt
ctggggacgctgtctgcctttgcgacgtctccagaggtggctctcaagatctggcagtgc
ctcgagggagcccagatcctccccgtccgtcaggggggtctcgcccccaacccaccaccg
ggcatccagacggagctggaagaagtggaagcccgcaacgaggagttccctatcacgcgt
gcgctgctcaagctcgtctctgccctggtggaccacccgctgccatcctctgctcacggg
gcggcgctcctgcggtcggggctggacccttacatggactttgtgagagacgcagttttc
ctcaagtttcacattcgagcctacaagcaggaggaggagaagtgggaagtggccaggctg
tgcctggagatcattgaaaaactgctcaggaagcacggtgtggggccgggcatcgacgca
gccaagcttttggcttcagacactccccccctggggacccaagtggccttcaaccttttg
gcacacctcttgcaagacggaaccttcctgcgtctcattctctttgtcctggatgaagga
gcgaggcagctcgagacctacctgcctttccccggacagaagcagctcgaagaggcagcc
ctgttgagcctgaggatcttacaccttgctctgcttcaacaagaacccttcctgcatcag
gtgcggaatagcaacgcagctctcattgtgagctccatgaaccaacttctaatggctgcc
aaccctcggacaggcaggccagactacggcttggtcatctcgcagtacgtgacatacaac
acattccttccgtggcacaccctggttgcctctcggatccttcttttgctctgtggtcag
tcaaaaatggcagaacatcttgccactgcattcactttcgagaagatgcaaggactccgc
ttgatccacggcttcgcagagtctctagatgtggacttgggtccggaccctccagcaggc
aatgaaagagactggacactgcgtgaagtccgcactgcaagcagtcacacacttctcaag
atgcttctcagctgccttgaacaccctgttctcaatgtggggcattacctgctcggcttc
gatatcaaacgtagcattgccaagactactttgcaagagccaggtgtcctggggtctgca
aggacttgccttcatgccatcctctcgtttttggacaactcatcggaggcccgagtaccc
ggtggacccccctcggtagttgagttaggctacaagctggtttacgtgctgtgtgccaac
cctgcgaccactgaacccaccatgcgttacctgcggtccacacgggacttcttctacaag
cacctccaaaagcagcccaaaagatacctcaagagtcatggggacacagatgtcaagctt
ctcatgcagcagtcctggtttctacgagctgtggcgctagaactgcgcgtaactgcttca
caaaatcagcgttcacacatccaaaggctcgtgacactcctcttggaagacaatcctcaa
ttgctgacctgccccattgacggagcagcagagctctctagctttctgtcttcaagcgct
tctatgcgtccgagtgcctttgcgggcaccctccggcgtaagcttctcaagcttctggat
gctgtggacaccatgaagcacactgtgccctcggctcccacctgggaataccttgattct
gtcgagttagagagggccttagcagaatgcgagtatcaggagcccggaggacccatcatg
atagatgtcggagcagtacaccagaggctcttggaggcatctgccaagctgcagggcttt
gtagcattggggcagaaatccatggtggtccaagaggtcaaggcagttctccaatacact
ttggccaagaaccgttgttgccagggctcctttgctaagagacactactttctggcctgg
cagcagctggtggaggtggtggtgactgtgtgtccccaggacatctttggaggggacctc
aagattcaggttctcctggaggtggctcaagaactcctgagaaggcttctggatgggaac
agcctgacagatctgctagcaccttcttcaggagtgctacttgtcctcatggcagctctg
caccactgccttctcaccatgggtcatttgcttaggatgagtggccgtagagcagaccat
tcaaatgtgttaacacatctaatgccaaaccgttctactgcccaggacaccgcactgcag
gtgtccttgacgacctactcttcgtccatcctggcggtgctcaagagtctcctcgagtgc
ctcatccagactggcagtggcttccagcgcgtcagagccaactactacggctccctcctc
aatttgctgcgggtggtccacaggtcgccagagacccaaggagctcccggaggtggtgtg
gacagggtgttcgaggactcttcttcggacggcgaaaggctgcgcaagagccacgcggag
gcccttttcagctacggggagcagctgatggaagtagtgtgcagggacgtgtgcgggagc
catgagatcacccagatgctgtccctggccgcgcttgacgcagtggtgtccctcgacacc
cacgggcactggctgtcctacctgtgccgcaagggatacctgcaccacctgacggacggc
gtctcgtctgcggacgccgacatccggaccgtgctcgtcaagggatcttccaagggcagt
tccttgcggagcctgtacgtcctcgagtctaagctctctctgctgacccgcctggctgcg
agccctgctggtgcccaggccctcctggagagcggcctggtggggaagctcgccgagtgc
gaagctctcgacctgtaccccagcatcgccggagggctgcccgaccttgcttctcggtgg
ccgtgtccgccggcgaccaagtgctaccaacagctcttcgtgccggtggcgcaactcctg
ctctcgatcgccgcgtccctgggtcccggacacaaggaggccggcttccaagtgcggaac
tttctgggcgcgcacgcccaggtgttttcggccatgctgcagcccagaaacttggagaac
tcggatttgacggcgctagaagaagctgcgctggcgtctgcgctcgtggcggtgctggct
gacggcgcggaagacgacgacgacgtggcgctgctggagcatcaggggcacctgaggatg
ctccagaaccagatgctctcgttgctgtcgtggctggtgcccgaagccgacgcggcgtcc
caacttccgcacgaacgaatcttacggctgcgcatttcctgcagtgtattccgcttctgt
agttcgttgtgcagacttgcgggcgcaaaagacaggaagtggttccgcattttgtttgca
ccgacggcgagcgtggaggcgcccccgcggagcggacgcagcggtgtgtctggtgtcatc
gctgctcctcctccagggctcgggctgctggtacgggcgttgctggcatactccgccgaa
gcgcagcggactgcggttgcccgcgactgtctcgcccggaagttggccgcgctcgacgac
ctcgggtctgcggaactcgccgagctgctcctcgcggcggaccaagaccagccgtcgtct
ctgcagccggggaagctgcgcgaggctgccaggaggcagatcggtcgcgaggcggcgctg
gcgaagaaggagttatcgctgcttacggtcgccgtcgagcaggcgctgttcctgctctgg
agacacctcgagtacttcctggtgcagtgcgtgccgagcgggcgggccaagaggggactg
gtcaggccggccgaggggcagttcggaacacccatgcgcgagggcacgttggggcgcgtg
ccggcgagtgaagcagtcaccgtagaagacgtggaggcactgaaggcggatgtaaaggca
accttgaacgacgccttcttccgcggcgtccaagtcagggagagctacctccgggaggag
agtgcatcttcgtccaatcccagattcttcgaggctctgttgaggaggctgaagaggctt
gccacattacaggcgcactga

DBGET integrated database retrieval system