KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW009676Help
Entry
IscW_ISCW009676   CDS       T01131                                 

Definition
protein O-mannosyltransferase, putative (EC:2.4.1.109)
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:isc00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    IscW_ISCW009676
Enzymes [BR:isc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     IscW_ISCW009676
Glycosyltransferases [BR:isc01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   IscW_ISCW009676
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 720 aa AA seqDB search
LNGDFQPFSVNIEVDGMAVALFLLGLFTRMWRLEEPRSIVFDELHYGKFASLYMKNTFFF
DSHPPLGKQLVALAGYLAGFDGNAQFDRIGGSYSASVPLWALRFVPAFFGSLLVPTTYHL
ATSLGLARSSAALAAILMLLENSLLTQSRFILMESILICFAALGLLCLLKFRQSDQRRPF
SFGWWFWLVLSVAFLTCALCVKYIGMFSILLAVYIMARDFWNMLGNSAISDAKLWLHFMC
RSAVTVVVPTCIYLGVFYVHLNTLTKAGPHDNIMTSAFQASLEGGLASITKGQPLAVVHG
SQVTLRHTHGRACWLHSHPHVYPIKYPDGRGSSHQQQVTCYSFKDVNNWWIVKRPDIKDI
VVSEPPDQIKHGDIVQLIHGMTSRALNSHDVASPMSPQHQEVSCYINYNISYPSQNLWRV
DILNKDTEGDTWHTIHSHVRLVHVNTSQALKFSGKQLPDWGFHQHEVVTDRFLVQDDTVW
NVEEHRYTKNSDEKERERDMVSAEFVPLQPTHLSFLQKMWELQYKMLLVNQENVQDHVYS
SDPMEWPLMTRGIAYWVSPTTNAQIHLIGNLAIWYTGTVCLLLYMAIFSFYVLRRHRLVY
DIPDDAFERFKFGGELCVVGYAMHWSPLTHVSPPLQQYHLVAVLVFSYLILLNLLDESYS
SLLKKWLQFGYYAGLCLWMLSVVYVFWKFSPFCYGTTALSADEVQALKWKDSWNFIIHRP
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
ctcaatggagacttccaaccgttctccgtcaatattgaagttgacgggatggcggtggca
ctgttcttactcggactgttcacgagaatgtggagactggaagaaccgaggagcattgta
tttgatgagctgcattatggaaagtttgccagcttgtacatgaagaacacatttttcttt
gattctcatccaccactgggaaagcagttggttgcactagcaggatatcttgctggattt
gatggcaatgcccaatttgacagaattggtggaagttacagtgcgtcggttccactctgg
gctctgcggtttgtgccggccttctttggctcgcttttggttccgacgacgtaccatctg
gccacgtctctaggcttggctcgaagctcagcggcattggcagccatcctcatgctgctc
gagaactctctactcacacagtctcggttcatactcatggagagcatcctcatatgcttt
gccgccctgggactgctttgcctgctcaagttcagacagtctgaccaacgtcggcccttt
tcttttggctggtggttctggctggtcctgtctgtggccttcctcacctgtgctctctgt
gtaaaatacattggcatgttctcgatcctgttggctgtctacattatggcacgtgacttt
tggaacatgcttggaaacagtgcaatttctgatgccaagctctggctccacttcatgtgc
cgatctgcggtcacagttgttgtgccgacgtgcatctacctgggggtgttttatgtgcac
ctcaacaccctcaccaaggctggaccacatgacaacatcatgaccagtgcttttcaggcc
agcctggagggtggtctggcctccatcaccaagggacaacccctggcagtggtgcacggt
tcccaggtgactctacgtcacactcatggacgggcctgctggctccactctcatccccac
gtctaccccatcaagtaccccgacggaaggggcagttcccatcagcagcaggtgacttgc
tacagcttcaaagatgtgaataactggtggattgtcaaacgcccagacataaaggacatt
gttgtttctgagccaccagatcagatcaagcatggcgatattgttcaacttattcacggc
atgacaagccgtgcactcaacagtcatgacgttgcatcaccaatgtcaccccagcaccag
gaagtttcatgctacatcaactataacatatcctacccttcccagaatttatggcgtgtg
gacatcctcaataaagacacggaaggggacacatggcacaccattcactctcatgttcgt
cttgttcacgttaatacaagccaagcactgaagttcagcggcaaacagttgcctgactgg
ggtttccaccaacacgaggtggtcactgatcggtttctggttcaggacgacacagtctgg
aatgtggaggagcatcggtatacaaaaaattcggatgaaaaagagcgtgaacgggatatg
gtgtctgccgaatttgtccctctccagccaactcacctttcatttcttcagaagatgtgg
gaactacagtacaagatgctcttggtgaatcaggaaaatgtgcaagatcacgtgtacagc
tcagatcccatggagtggcctctgatgacccgaggcattgcatactgggtcagcccgact
accaatgctcagattcacctgattgggaacttggccatctggtacacgggcacggtctgc
ttgcttctgtacatggcaatcttcagcttctacgtgctgagacgtcacaggctcgtctac
gacattcccgacgatgcctttgaaaggtttaagtttggaggagaactgtgcgtcgtgggg
tatgcgatgcactggagcccccttactcatgtttcccctcctcttcagcagtaccacttg
gttgcagtgcttgtattctcttacttgatactgctaaacttgttggatgaaagctacagc
tcattgttgaagaagtggcttcagtttggctactatgctggtctctgtttgtggatgctg
agtgtggtctacgtgttctggaagttctcccctttctgctatggaacaactgcactttct
gccgacgaggttcaagccctcaagtggaaggactcgtggaacttcatcattcaccgtccc
tga

DBGET integrated database retrieval system