KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW009943Help
Entry
IscW_ISCW009943   CDS       T01131                                 

Definition
laminin gamma-1 chain, putative (EC:2.7.10.1)
Orthology
K05635  
laminin, gamma 1
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
ECM-receptor interaction
Class
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:isc04512]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 1278 aa AA seqDB search
CNCNGRSRKCYFDKELYDRTGHGGHCINCSDNTDGPNCERCRENFYQRSDGRCVACGCDP
LGSRVLQCNSKGQCPCKPGVEGQRCDRCAPNFYDFSEQGCRPCGCSMAGSVDSPPSCDAA
TGVCRCKANVEGRQCDRCRPGFFNLQRDNEFGCTPCFCFGHSAVCQSAPGYSKHTVYSTF
TRDKEHWKAVDSRGARVPTRHEYAAHHLAVAAPGENQVYFVAPERFLGDQRGSYNQNLTF
TLRIGEEGARSSLEDVVLESPSQSVSQHIFGQGNPLPSIRNQDYRFRLHQDSRYGWSPTL
SAHEFMALLANLTAIKIRATYLPRGESTLHRLVCGGKKGVGGLPGIGQGILIPPDKFCDP
SEYTTSSCRATLQHHTFRVSNRYGCPRQTNPRHWCSSLGHCICQHNTAGEFCERCAPRFY
GNALVGSPEDCQPCPCPDQGACAVLPDESVVCLECPQGYSGGRCDLCFDGHFGDPQGRYG
AERPCQKCDCNDNVDPNAVANCNTTTGECLKCIYKTAGFHCEKCLPGHYGDALAVPKGDC
KRNMQLLSLGSTSDQCDPVTGQCPCRPNVAGRECGQCREGTWNLEGGQGCEQCGCHLVGS
VNRTCDQRTGQCHCRPGVGGKRCDQCLPYHYGFSPDGCLPCDCDSLGSVSLQCAPDGQCE
CRPNVEGRRCERCKENKYNREAGCVDCPTCYNLVQDAVNQHRDKVADLARLLDNIEKNPQ
IVKSVDFEKKLEEVMVIVNDLWKDAKQASGTDKSLADRLEELVRRMHRVQETASKVGQET
WLAEEALWAAQSNLSQAEASVERMGTTLAQAHRFLEDEGQHALRRALERSHRFGQQSEMM
SQIARDARQLADRMKDIMDLMLRTKKMAEEAKAEVVKAYEDALRVYSDTTSVQMPDIDTD
DLLHQAQEIIEEVRQPLGRAISSLYDCAIEQQNHSQCCEKEPRSGQKGSKPQRSFTFKMQ
AQRIYKEADDLMEKHKNIFDKVKPQKDEAEDLLAEAQRQQQVTDELLADTDAAYAKAKEA
VQSGEKILEEAQNTLKTLKEFDENVKNSKEKARAALERVPEIRALIEEAENKTADARDAL
KDAEEDANAASDIATQAERIAEQASKVRHERLAKTMAATTLTSRACRKGGRRAYKLQAAT
EDHFAVYRPKRHNKISCNLRFKFSKDATSLKLRGNMKSADLRRWGERLSPVPVAANVDEV
DPGRLDELERRLAEAERELERARLAERLAELQKAREQQVLWMRDYEDEINQLKKDVANVR
LISEALPDKCYRRIRLEP
NT seq 3837 nt NT seq  +upstreamnt  +downstreamnt
tgcaattgcaatggccggtcccgcaagtgctactttgacaaggagttgtacgaccgcacg
ggccatggcggccactgcatcaactgcagcgacaacaccgacggccccaactgcgagcgc
tgccgggaaaacttctaccagcgcagtgatggccgctgcgttgcctgcggctgcgacccc
ttggggtcccgtgtgctgcagtgcaacagcaagggccagtgcccgtgcaagcccggcgtg
gaagggcagcgctgcgaccgctgtgctcccaacttttacgacttttcggagcagggctgc
aggccgtgtggctgcagcatggccggcagcgtggacagtcctccttcgtgcgacgctgcg
acgggcgtctgccgttgcaaggccaacgtggaggggcgccagtgcgaccgctgccgcccg
ggcttcttcaacctgcagcgggacaatgagtttggctgcaccccgtgcttctgcttcggc
cactcagctgtctgccagagtgccccgggatactccaagcacaccgtctacagcaccttc
accagggacaaggagcactggaaggcggtggactcccggggtgcccgagtgcccacccgg
cacgagtacgccgcccaccacttggccgtggctgctcctggcgagaaccaggtctacttc
gtggcaccagagcgtttcctgggcgaccagcggggctcgtacaaccagaacctgacgttc
acgctacgcattggggaggagggtgcccgctcgtccctggaggacgtggtgctggagagc
ccgtcgcagagcgtgtcgcagcacatcttcggccagggcaacccgctgccctccatccgc
aaccaggactaccgcttccggctgcaccaagactcccgctacggctggagccccaccctc
agcgcccacgagttcatggccctgctggccaacctgaccgccatcaagatcagggccacc
tacctgcccaggggtgagagcacgctgcaccgcttggtttgcggaggaaaaaagggtgtg
ggtggtttgcctggcatcggccagggcattttgatacctccagacaagttttgtgaccct
tcagaatatacaacatcaagctgtagagcgaccttgcaacatcacacttttcgtgtgtcc
aatcgctacggctgcccccgacagactaacccccgccactggtgttcctctttaggccac
tgcatttgccagcataacacggcaggggagttttgcgagcggtgcgctccccgcttttac
ggcaacgcactagtgggcagccccgaggactgccagccgtgcccgtgccccgaccagggg
gcctgcgcggtgttgcccgacgagagcgtcgtctgccttgagtgcccccagggctactct
ggtggacgatgcgacttgtgctttgacggccactttggcgaccctcagggaaggtacggg
gcagagaggccctgccagaaatgtgactgcaacgacaatgttgatcccaacgctgttgcc
aactgtaacaccaccaccggggagtgcctgaagtgcatatacaagacggccggcttccac
tgtgagaagtgccttccaggacactatggagacgccctcgccgttcccaagggagactgc
aaacgtaacatgcagctgctcagcctgggctctacaagcgaccagtgcgacccggtgacg
ggccagtgcccgtgccggcccaatgtggccggacgtgagtgcggccagtgccgcgaggga
acctggaacctggaagggggccagggctgcgagcagtgcggctgccacctggtgggctcc
gtgaaccgcacttgcgaccagcgcacgggccagtgccactgccggccgggggtgggcggc
aagcggtgcgaccagtgcctgccttaccactacggcttctcccccgatggctgcctgccc
tgcgactgcgacagcctaggctcggtgtccctccagtgtgccccggacggacagtgcgag
tgccgtcctaacgtggagggccgccgctgcgagcgctgcaaggagaacaagtacaaccgg
gaggccggctgcgtcgactgccccacctgctacaacctggtgcaggatgctgttaaccaa
cacagagataaggtggcagaccttgcgaggctactcgacaacatcgagaagaacccccag
atagtgaaaagtgtggactttgagaaaaagctggaagaggtcatggtcattgtgaatgac
ctgtggaaagatgcaaagcaagcctctggcacggacaagagcctggcggaccgtctggaa
gagctggtgcggcgcatgcaccgggtgcaggagacggcctccaaagtggggcaggagacg
tggctggctgaggaggcgctctgggccgcccagagcaacctgtcccaggccgaggccagc
gtggagcgcatgggcaccaccctggcacaggcgcatcgcttcctcgaggacgaggggcag
cacgctctgcgcagggccctggagcgctcccaccgctttggacagcagtccgagatgatg
tcgcagatcgcccgcgacgctcgccagctggccgacaggatgaaggacatcatggacctg
atgctgcgtaccaagaagatggcggaggaggccaaggcggaggtggtgaaggcgtacgag
gacgccctgcgggtgtactcggacaccacctcggtccagatgccggacatcgacacggat
gacctgctgcaccaggcacaggagatcatcgaggaggtacgccagccattggggcgggcc
atctcctcactttacgattgtgcaattgaacaacaaaatcactctcaatgctgtgaaaaa
gagcctcgtagtgggcaaaagggaagtaagccacagcgatcgttcacttttaaaatgcag
gcccagcgcatctacaaggaagcggatgacttgatggagaaacacaaaaacatcttcgac
aaggtgaagccgcagaaggatgaagcggaggatctgctggctgaagctcagcgacaacaa
caggtgacagatgagctcctggcggacacggacgcggcctatgccaaggccaaggaggcc
gtccagagtggggagaagattctggaagaagcccagaacacgctcaagacactcaaagag
tttgacgagaacgtcaagaacagcaaagagaaagccagggctgccctggagagagtgccg
gagatccgggctctcatcgaagaggccgagaacaagacggcggatgcgcgggacgcgctc
aaggacgcggaagaagacgccaatgccgccagcgacattgccacccaggcggaacgcatc
gccgagcaggcctccaaggtacgtcatgagcggttggccaaaaccatggccgctacgaca
ttgacgagtcgtgcatgcaggaagggaggaaggagagcctacaaactacaggctgcgacc
gaagatcatttcgcggtctataggcctaaaaggcataacaaaattagctgcaatcttcga
tttaaattctcaaaagatgcaacttctttaaagctccggggaaatatgaaaagcgccgat
ctgcgtcgatggggtgagaggttgagccccgttcccgtcgcagccaatgtggacgaggtc
gatcccggtcgtctggacgagctggagcgaaggcttgcagaggcggagcgggagctggag
cgggcgcgtctggcggagcggctggcggagttgcagaaagcccgcgagcagcaggtgctc
tggatgcgcgactacgaggacgagatcaaccagctgaagaaggatgtggccaacgtgcgg
ctcatcagcgaggccctgccggacaagtgctaccgccgcatacggctggagccctga

DBGET integrated database retrieval system