KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW010016Help
Entry
IscW_ISCW010016   CDS       T01131                                 

Definition
enoyl-CoA hydratase, putative (EC:4.2.1.17)
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Brite
KEGG Orthology (KO) [BR:isc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    IscW_ISCW010016
  Carbohydrate metabolism
   00640 Propanoate metabolism
    IscW_ISCW010016
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    IscW_ISCW010016
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    IscW_ISCW010016
Enzymes [BR:isc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     IscW_ISCW010016
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 386 aa AA seqDB search
IGCKWSLRSLERLRLVRRALGILQGLRAMSSETGDVIVEKVGNKGVIILDRPKALNALSL
DMIRQIYPTLKKWDTDPDMKMVIIKAKKDSKAFCSGGDVKAIAQTKGQDTNLRDAFFREE
YRLNNLIASLTIPYVALLDGVTMGGGVGLSVHGTFRVATERTVFAMPETAIGFFPDVGGS
YVLPRLPGKLGLFLGLTGYRLVGWDVLKGRIATHFSSSQRLENLEGDLMRLASPNISDID
KILLKHQDQCEADFRKEFGLKKFMGRINSAFNAPSVEAIIENLSKDTSEWGQEQAKVLQK
MSPLSMKVTFRELQEGSTLTLQDALKMEFRLSQRFMQDSDFFEGYRQLLIERSGEPKWNP
ATLAEVTEEKVDSYFEPLPADKELRL
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atcggatgcaaatggtcgctgcggtctttagagagactcagactcgtgcgtcgagcgttg
gggatccttcaaggactcagagccatgtcatctgagaccggcgatgtgatagtggagaag
gtcggcaacaaaggcgtcatcatcctggacagacccaaggccctgaacgccctttctctc
gacatgattcggcagatctacccaaccctcaagaaatgggacacggacccagacatgaag
atggtgatcatcaaggccaagaaggactccaaggcattctgctctggaggggacgtcaag
gccattgcccagaccaagggccaggacaccaacctgcgggacgccttcttccgcgaggag
taccgcctcaacaacctcatcgccagcttgacgattccgtacgttgctcttttggatggt
gttacaatgggagggggggtgggtctttccgtccacggcactttccgggtggcgaccgag
cggaccgtctttgccatgccggagactgccattggtttcttcccggatgtcgggggcagc
tacgtgcttccaaggctaccggggaagttgggcctcttcctgggactgacggggtaccgc
ctggtcggctgggacgtcctcaagggtcgcattgccacgcacttctcctcctcccagagg
ctcgagaatctggagggtgacctgatgcgccttgcgagtcccaacatctcggacattgac
aagatcctgctgaagcaccaggatcagtgcgaagccgacttccgcaaggagtttggcctc
aagaagttcatgggtcggatcaactcggccttcaacgcccccagcgttgaagcaatcata
gaaaatctcagcaaagacacctctgaatggggccaggaacaagcgaaggtcctccagaag
atgtctcccctgtcaatgaaggtgaccttccgggagctccaggagggttccacgctcaca
cttcaggacgccctgaagatggagttccgcctgtcgcagcgtttcatgcaggactcggac
ttcttcgagggctaccgacaactgctcatcgaacgctcgggcgagcccaagtggaacccg
gcaacgctcgcggaggtcacggaagaaaaggtggactcgtacttcgagccgctgcctgcc
gacaaggagctgcggctctga

DBGET integrated database retrieval system