KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW010054Help
Entry
IscW_ISCW010054   CDS       T01131                                 

Definition
ubiquitin-specific protease, putative (EC:3.1.2.15)
Orthology
K11833  
ubiquitin carboxyl-terminal hydrolase 2/21 [EC:3.4.19.12]
Organism
isc  Ixodes scapularis (black-legged tick)
Brite
Enzymes [BR:isc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     IscW_ISCW010054
Peptidases [BR:isc01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   IscW_ISCW010054
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 340 aa AA seqDB search
LGLRNLGNTCFMNSIVQCLAHTRPLLEYCLKDCYTSEINNITSSNRGALFEAFATLMKSI
WRSSNGEYAISPQAFRSQIQKFAPRFMGYSQQDSQEFLHYLLQGLHEDINRITSRPRHVT
TEIDDNLSDSQKAAEAWKRYLRFDDSKIVDCFVGQLKSTLKCSVCGHKSVTFDPFWDLSL
PIPKSSDSVTIQQCLSLFTKEEVLDGDEKPTCSNCKTRQRCTKSFTIHRCPKILVLHLKR
FSPGERFRAKLNTRVEFPLTNLDLCPYMSNSHYVMYNLYAVSNHSGSTYSGHYTATCLHP
KSGEWHECNDTKVTEVSSSRVASSEAYVLFYEAATQSSRL
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
cttggactgcggaatctaggaaacacatgttttatgaactccatagtccagtgcctggcc
cacacacggcctctgctcgagtactgcctcaaggactgctacacctctgagattaacaac
atcacatcgtccaacaggggagccctctttgaagcttttgctactctgatgaagtctatt
tggaggagcagcaacggggagtacgccatcagcccccaggcattccgtagccagatacag
aaatttgctccccgatttatgggatacagccagcaagattcacaagagttcctgcactac
ctgttgcaaggcctccacgaggacatcaaccgcatcacctccaggccaagacatgttact
accgagatcgacgacaacctcagcgactcgcagaaagccgctgaggcctggaagcgatac
ctccgattcgacgacagcaagatagtcgactgctttgtcgggcagctgaagagcaccctc
aagtgcagcgtgtgtggccacaagtcagtcaccttcgatcctttctgggatctctccctt
cctattcccaagagctcagattctgtgactatccagcagtgtctgagccttttcaccaaa
gaagaagttctcgacggagacgagaagcccacctgctcgaactgcaagactcggcagagg
tgtaccaaaagcttcaccatccacagatgtccaaaaattcttgtgcttcacctgaaacgt
ttctcaccgggcgagaggttccgcgcgaagctcaacactcgcgtcgagttcccgctgacg
aatctcgacctctgtccatacatgtcaaacagtcattacgtgatgtacaacctgtatgca
gtctcaaaccacagtgggtctacttactcaggccactacaccgccacctgtttgcacccc
aaatccggggaatggcacgagtgcaatgacaccaaggtgacggaagtgagctcctcgcgg
gtggcctcatcggaggcgtacgtcctgttctacgaggcggccacgcagtcttcgcgcctc
tga

DBGET integrated database retrieval system