KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW010433Help
Entry
IscW_ISCW010433   CDS       T01131                                 

Definition
malonyl-CoA decarboxylase, putative (EC:4.1.1.9)
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Peroxisome
Class
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:isc00640]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:isc00410]
Cellular Processes; Transport and catabolism; Peroxisome [PATH:isc04146]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 342 aa AA seqDB search
MREDLLDLISSSQLESPSSYDVRHMNTILKELLSLWFTVGFMKLERITWQSSCEMLQKIS
DYEAVHPVRNWTDLKRRVGPYRRCYVITHSCMPGEPIVVLHTALTSSISASIQPDRAESQ
ASDEWEDDKVIKAAIFYSISSTQKGLQGIELGKYLIKGVVKEVKAEFPHIQDFSSLSPIP
GFKNWLVSEVHKIIKGQPESRKLLNQRELEEIVAPYREDREPLEAFLRLLRNNGWYQVPE
LVQRLEAPLMRLCAFYLYHEKRRGYALNGVANFHLKNGAVIWRLNWLGDISPRGLSASCS
IMVNYRYYLDEMETNRQKYLEHFTVPASDIFLEHLKPLQSSL
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgagggaagaccttctggatctaatctcgtcgtcgcagctggaaagtccttcctcctac
gacgttcgacacatgaataccattttgaaggaactcttatcgctctggttcaccgttggc
ttcatgaagttggagcgcatcacttggcagtcttcttgtgagatgttacagaagatctcg
gactatgaggctgtgcaccccgtccgcaactggacggatctgaagcgccgggtgggtccg
taccggcgctgctatgtcatcacccacagctgcatgccaggtgaacccatcgtggtgctt
cacacggcgctcaccagctccatctcggcctccatccagccggatcgggctgagtctcag
gcttccgacgaatgggaagacgacaaggtcatcaaggcggctattttctactcaatctct
tccactcagaaaggtctgcagggcatagagctgggcaagtacctgatcaagggggtcgtg
aaggaagtcaaggcagagtttccccacatccaggatttctcttccctctcgcccatcccc
ggcttcaagaactggcttgtttcggaagtccacaagatcatcaaaggccagccggaaagc
aggaagctcctaaatcagcgtgagctcgaggagattgtggcaccataccgggaagacagg
gaaccccttgaggctttcctgaggctgctcaggaacaatggctggtaccaggtaccagag
ctggtgcagcggttggaagcacctctcatgcgcctgtgtgccttctacctctaccacgag
aagaggcgcggctatgcgctcaacggcgttgcaaatttccatctaaagaatggtgccgta
atttggagactcaactggcttggagacatctctccaaggggactttcagcatcatgttcc
atcatggtcaactacaggtactacctggatgaaatggagacgaacagacagaaatatctc
gagcatttcaccgtccctgcctcggacatcttccttgagcacctgaagcctttacagtcc
tcgctataa

DBGET integrated database retrieval system