KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW010433Help
Entry
IscW_ISCW010433   CDS       T01131                                 

Definition
(RefSeq) malonyl-CoA decarboxylase, putative
  KO
K01578  malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
isc00410  beta-Alanine metabolism
isc00640  Propanoate metabolism
isc01100  Metabolic pathways
isc04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:isc00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    IscW_ISCW010433
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    IscW_ISCW010433
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    IscW_ISCW010433
Enzymes [BR:isc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     IscW_ISCW010433
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MCD MCD_N
Motif
Other DBs
NCBI-GeneID: 8036819
NCBI-ProteinID: XP_002403478
VectorBase: ISCW010433
UniProt: B7Q701
AA seq 342 aa AA seqDB search
MREDLLDLISSSQLESPSSYDVRHMNTILKELLSLWFTVGFMKLERITWQSSCEMLQKIS
DYEAVHPVRNWTDLKRRVGPYRRCYVITHSCMPGEPIVVLHTALTSSISASIQPDRAESQ
ASDEWEDDKVIKAAIFYSISSTQKGLQGIELGKYLIKGVVKEVKAEFPHIQDFSSLSPIP
GFKNWLVSEVHKIIKGQPESRKLLNQRELEEIVAPYREDREPLEAFLRLLRNNGWYQVPE
LVQRLEAPLMRLCAFYLYHEKRRGYALNGVANFHLKNGAVIWRLNWLGDISPRGLSASCS
IMVNYRYYLDEMETNRQKYLEHFTVPASDIFLEHLKPLQSSL
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgagggaagaccttctggatctaatctcgtcgtcgcagctggaaagtccttcctcctac
gacgttcgacacatgaataccattttgaaggaactcttatcgctctggttcaccgttggc
ttcatgaagttggagcgcatcacttggcagtcttcttgtgagatgttacagaagatctcg
gactatgaggctgtgcaccccgtccgcaactggacggatctgaagcgccgggtgggtccg
taccggcgctgctatgtcatcacccacagctgcatgccaggtgaacccatcgtggtgctt
cacacggcgctcaccagctccatctcggcctccatccagccggatcgggctgagtctcag
gcttccgacgaatgggaagacgacaaggtcatcaaggcggctattttctactcaatctct
tccactcagaaaggtctgcagggcatagagctgggcaagtacctgatcaagggggtcgtg
aaggaagtcaaggcagagtttccccacatccaggatttctcttccctctcgcccatcccc
ggcttcaagaactggcttgtttcggaagtccacaagatcatcaaaggccagccggaaagc
aggaagctcctaaatcagcgtgagctcgaggagattgtggcaccataccgggaagacagg
gaaccccttgaggctttcctgaggctgctcaggaacaatggctggtaccaggtaccagag
ctggtgcagcggttggaagcacctctcatgcgcctgtgtgccttctacctctaccacgag
aagaggcgcggctatgcgctcaacggcgttgcaaatttccatctaaagaatggtgccgta
atttggagactcaactggcttggagacatctctccaaggggactttcagcatcatgttcc
atcatggtcaactacaggtactacctggatgaaatggagacgaacagacagaaatatctc
gagcatttcaccgtccctgcctcggacatcttccttgagcacctgaagcctttacagtcc
tcgctataa

DBGET integrated database retrieval system