KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW010469Help
Entry
IscW_ISCW010469   CDS       T01131                                 

Definition
phosphatidylinositol 3-kinase catalytic subunit, putative (EC:2.7.1.153)
Orthology
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
Inositol phosphate metabolism
FoxO signaling pathway
Phosphatidylinositol signaling system
mTOR signaling pathway
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:isc00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    IscW_ISCW010469
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    IscW_ISCW010469
   04068 FoxO signaling pathway
    IscW_ISCW010469
   04070 Phosphatidylinositol signaling system
    IscW_ISCW010469
   04150 mTOR signaling pathway
    IscW_ISCW010469
Enzymes [BR:isc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     IscW_ISCW010469
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 491 aa AA seqDB search
MLWFLCARTLQMQALLQIWKLLKPEQALELLDYSYPDNYVRSFAVRCLRQMSDEELSLYL
LQLVQALKHESFLDCDLVKFLLERALKNRHIGHQMFWLLRCEMQVAALSVKFGLILEAYC
HGAPDHREALLKQAEALFKLRALGNQIHESSKKKDSREKMVATMREHMSKEAFRATFRNL
CSPLDPCHVFSQIKPELCRFMDSKMKPLWLVFENSDAVAEDIAIIFKHGDDLRQDMLTLQ
MIRIMDKLWKDEGYDFRMIPYQCLSTDQNVGLIEVVRNASTIANIQKLHNSSATSAFKKG
SLFAWIKEHNKTQESLRRAVENFTLSCAGYCVATYVLGVADRHSDNIMIKANGELFHIDY
GHILGKFKEKFGIKRERVPFVLTHDFVHVITHGHRRKATAFNRFQEYCERAFLILRRQGS
LMISLFAMMLTTGMPELTSEKDLDYLRDALVLDYSEADALAHFRAKFEEALNNSWTTSIN
WFAHNISKDNK
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgttgtggtttctgtgtgcacggaccttgcagatgcaagcccttctgcaaatttggaag
ctgcttaaaccagaacaggcgctggagctcctagactacagctatcccgacaactacgtg
cggagttttgctgtccgctgcctacgacagatgagtgatgaagaactgtccctgtacctg
ctgcaactagtccaagctctgaagcatgaatccttcctggattgtgacctagttaagttt
ctactggagagagcgctcaagaataggcacattgggcaccagatgttctggcttctaagg
tgtgaaatgcaggtggcggcgctaagcgtcaagttcgggctgattcttgaggcgtactgc
cacggggcccccgaccacagagaggccctcctgaagcaggccgaggctctcttcaagctc
agggccctgggaaatcagatccacgagtcgagcaagaagaaggacagccgagagaagatg
gtggccacaatgcgggagcatatgagcaaggaggccttcagggccaccttcaggaacctg
tgcagccccttggacccatgccacgttttcagccagatcaagccggagctttgtcggttc
atggactccaagatgaagccactgtggcttgtcttcgagaacagcgacgcagttgcagag
gacattgctatcatcttcaaacacggagacgatttgagacaagacatgctcaccctccag
atgatccgtatcatggacaagctctggaaagacgaaggatacgacttcaggatgataccg
taccagtgcctctcgacggaccaaaatgtggggctgatcgaggtggttcgcaatgccagc
accatcgccaacatccagaagctgcacaactctagcgccacttccgcttttaagaagggt
tccctctttgcttggatcaaggaacacaacaagacgcaggagagtctccgcagggcggtg
gaaaacttcaccttgtcctgtgcaggatattgtgtcgccacctacgtccttggagtggcc
gataggcacagcgacaacatcatgatcaaggcaaatggagagctgtttcacattgactac
ggtcatatcctgggcaagttcaaggagaagtttggcatcaagcgggagagggtgcccttt
gtacttactcacgactttgtacacgtcatcactcacggccacaggcgcaaggcgacggcc
ttcaacaggttccaggaatactgcgagcgggccttcctgatcctgcgtcgccagggttcg
ttgatgatctcgctgttcgccatgatgctcaccaccggcatgcccgagctgacctccgag
aaggacctggactacctccgcgacgcactggtactggactactccgaggcggacgcactt
gcccatttccgagcaaagtttgaggaagctctgaacaacagttggacaaccagcattaac
tggttcgcacacaacattagcaaggacaacaaatag

DBGET integrated database retrieval system