KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW010715Help
Entry
IscW_ISCW010715   CDS       T01131                                 

Definition
(RefSeq) hypothetical protein
  KO
K11836  ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.4.19.12]
Organism
isc  Ixodes scapularis (black-legged tick)
Brite
Enzymes [BR:isc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     IscW_ISCW010715
Peptidases [BR:isc01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   IscW_ISCW010715
Ubiquitin system [BR:isc04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    IscW_ISCW010715
Exosome [BR:isc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   IscW_ISCW010715
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-UBP UCH UCH_1
Motif
Other DBs
NCBI-GeneID: 8036929
NCBI-ProteinID: XP_002403835
VectorBase: ISCW010715
UniProt: B7Q792
AA seq 276 aa AA seqDB search
MSLEGGFDVAEGKKYEYEYHNALTILPHFDVIPLPNPELPEKVQLSVATVLASDSANQLN
EQQAMAGTWDGEKRAVSKHSETLQQLDNGVKVPPHGWRCEMCNLTENLWMNLTDGAIMCG
RKFFDGSGGNNHALDHYKRSGFPLAVKLGTINPDGADVYSYDEDDMVLDSNLTKHLEHFG
IQISKMHKTDKSMVELEIDMNQRIGEWAVIQESGHQLVPLYGPSYTGLANLGNSCYLNSV
MQVVLAIPEFQNKYYEDASRTFDNSPPDPTQDFTVQ
NT seq 830 nt NT seq  +upstreamnt  +downstreamnt
atgagcttggaaggtggctttgacgtagctgagggcaagaagtatgaatatgagtaccac
aatgcactgacgatcctcccccatttcgacgtgatccctctgcccaatccggaacttcca
gaaaaggtgcagttgtccgtggccaccgtcctggcttcggattcggccaaccagctcaac
gaacagcaggcgatggctggcacctgggacggggaaaaaagggcagtttccaagcacagc
gagaccctgcagcagctggacaacggggtgaaggtgcctccacacggctggcggtgcgaa
atgtgcaacctgacggagaacctctggatgaacctgacggacggagccatcatgtgcggc
cgcaagttctttgacgggagcgggggcaacaaccacgccttggaccactacaagaggtct
ggctttcccctggctgttaagctgggcaccatcaacccggatggcgccgacgtgtactcc
tacgacgaggacgacatggtactagactctaacctcaccaagcacctcgagcattttggg
atccagatatccaagatgcacaaaacggacaagtcgatggtggagctcgagatcgacatg
aaccagaggataggggagtgggcggtgatccaggagtctgggcaccagctggtgcctctg
tatggcccctcgtacactggcctggcgaacctgggcaactcgtgctacctcaactcggtc
atgcaggtggtcctcgccatccccgagttccagaacaagtattacgaggacgccagccga
acctttgacaactcccctcccgatcctactcaagacttcactgtccagat

DBGET integrated database retrieval system