KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW010824Help
Entry
IscW_ISCW010824   CDS       T01131                                 

Definition
elongation factor 2 kinase, putative (EC:2.7.11.20)
Orthology
K08292  
elongation factor 2 kinase [EC:2.7.11.20]
Organism
isc  Ixodes scapularis (black-legged tick)
Brite
Enzymes [BR:isc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.20  elongation factor 2 kinase
     IscW_ISCW010824
Protein kinases [BR:isc01001]
 Serine/threonine protein kinases: Atypical group
  Alpha family [OT]
   IscW_ISCW010824
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 661 aa AA seqDB search
MGAAQRWQRAARRALHMEDPWAGRHLERLQEERVHRLRYNALTREWLEDQALVKMEAQPF
GRGAMRECFRLKKLSSFVPGQNWNHACNYVAKRYLEPTQRETYLEDVRLQMDAKLWAEEF
NRHNPPKKVDIFQVSVIEFVEREGRPLYHLEHFIEGSYTKYNSNSGFISSQDTRLTPQAF
SHFTFERSGHELLVVDVQGVGDLYTDPQIHTAGGQDYGEGNLGVRGMALFFHTHRCNCVC
KGLGLTPFDLAPHERPQVTPSFERIQRGGGATCARPWLRPCGSARAAAASGATASRHRRP
SVSLRVMRIDSLPLFETLGESVDSGVLERMCRKRNQSFWRLLNGAQRQLDKRKVVTGRFS
GELTRIGYGSGTRKRLPQPEQRQRGHQRRGRRPDPGQDTTRNANPRCNRVWPFFQEHDRA
EFQRLVAQRARPSCVLGEVQLRQLGQQLPATQSRSVLGQIHLEMARCHQTGRFGAEEDEE
GDYDQEAAVFHLEQAAQCGALEALLELARAHLGMPHDLLPDWSPPETEESVSRGVEYLEQ
AARAGDRWSMITLAKALDTGAGLGGQRERNWAEACLWYGLALSRTERDDEGEYDGCMDDP
DYLLLARQAELTLLGGHGLDRDPQAAGELYQRAATAATMAMKGRLANKYYQLAEEAAQEQ
A
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgggtgcggcccagcggtggcagcgggcggccaggcgggccctgcacatggaggacccc
tgggcggggaggcacctggagcggctgcaggaggagcgagtgcaccggctgcgctacaat
gccctcaccagggagtggctcgaggaccaggccctggtcaagatggaggcacagcccttc
ggccgcggagccatgcgggagtgcttccgactaaagaagctgtccagcttcgtccccggc
cagaactggaaccacgcgtgcaactatgtggccaagcggtacctggagccgacgcagcgg
gagacctacctggaggatgtgcgactgcagatggacgccaagctctgggcagaggagttt
aaccgccacaacccacccaagaaggtggacatcttccaggtgtcggtgatagagtttgtg
gagcgtgagggccgtcccctgtaccacctggagcacttcatcgaggggagctacaccaag
tacaactccaactcgggcttcatcagcagccaggacaccaggctcacccctcaggcattc
agccacttcacctttgagcgctcggggcacgagctgctggtggtggacgtgcagggggtg
ggggacctgtacacggacccccagatccacacggcggggggccaggactacggggagggc
aaccttggggtgcggggcatggccctcttcttccacacccaccgctgcaactgcgtctgc
aagggcctcggcctcacccccttcgacctggcaccccacgagcggcctcaggtaacgccc
tcctttgagcgaatccagaggggcggcggagccacctgtgcgaggccctggctccggccg
tgcggcagcgctcgcgcagcagcagcgagtggagcgaccgcatcaaggcacagacgcccg
agcgttagtttgagggtgatgcgaatagattctctcccattgtttgaaactttgggagaa
agtgtggactctggggttttggagcggatgtgtcgtaagagaaaccaatctttctggcga
cttttaaacggagcacaaaggcagttggataaacgaaaagtcgttaccggtcgtttttct
ggagagcttacgagaatcggttatgggagtggcacccggaaacggcttccgcagcctgag
cagcggcagcgagggcaccaacggcgaggacgaagacctgaccctgggcaagacaccact
cgaaacgccaaccctcgctgcaaccgagtgtggcccttcttccaggagcatgaccgggcc
gagtttcaacgcctggtggcccagcgcgcgcgcccgtcgtgcgtgctcggggaggtgcag
ctgcggcagctgggccagcagctgcccgcgacccagagccggtccgtgctgggccagatc
cacctggagatggcgcgctgccaccagacggggcgctttggggccgaggaggacgaggag
ggggactacgaccaggaggcggcggtgttccacctggagcaggcggcgcagtgtggggcc
ctcgaggccctgctggagctggccagggcgcacctgggcatgccccacgacctgctgccg
gactggagcccgccggagactgaggagagcgtgtcccgcggagtggagtacctggagcag
gcggcgagggcgggggaccggtggtcgatgatcacgctggccaaggcactggacacgggg
gcggggctgggcggccagagggagcgcaactgggccgaggcctgcctctggtacggcctg
gcgctcagccggacggagcgggacgacgagggggagtacgacggctgcatggacgacccg
gactacctgctgctcgccaggcaggccgagctcaccctcctggggggacacgggctcgac
agggacccccaggctgcgggggaactgtaccagcgtgcggccacagcagccaccatggcc
atgaagggacgcctggcaaacaaatactaccagctggccgaggaggccgctcaggagcaa
gcctag

DBGET integrated database retrieval system