KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW010827Help
Entry
IscW_ISCW010827   CDS       T01131                                 

Definition
protein disulfide isomerase, putative (EC:2.4.1.119)
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:isc00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    IscW_ISCW010827
Enzymes [BR:isc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     IscW_ISCW010827
Exosome [BR:isc04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   IscW_ISCW010827
  Exosomal proteins of colorectal cancer cells
   IscW_ISCW010827
  Exosomal proteins of bladder cancer cells
   IscW_ISCW010827
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 500 aa AA seqDB search
MLSLKFVTLLCALVAVHCEDYEKDEHVLVLKQTNFDKAVTEHKHVLVKFYAPWCGHCKAM
APEYVKAAKQLVDESSDIKLAKVDATIETQLAETYEVRGYPTLKFFRDGKPYDYKGGRTA
DEMVRWLKKRTGPAAEDLKSADAARTFVDASKVSVVGFFKDQASSEALQFLEAAEAIDAH
PFAITSDDAVYKELGASKDGVILFKKFDEGRSLMEGAVTSESVQSFVKTNSLPLVVEFTH
ESAQTVFGGQIKLHNLLFVSKKSPGFEDILKDYREAAKDFRHKVLFVTIDVDDEDHERIL
EFFGLKKDQVPVMRFVKLEGEMTKYKPEKDDLTPENVRSFVQDVLDGKLKQSLLSQDLPE
DWDRHAVKVLVNKNFDEVVFDKEKDVLVEFYAPWCGHCKQLAPIYDELAEKYKEKRPDLV
IAKFDGTANELEHTKMQGFPTIRLYKKGTNEAVEYNGERTLEGLSKFIDTDGEYGKAAPE
EVTEEEEEEEDKEDKKRDEL
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcgctaaagttcgtcacgttactctgcgctctcgtcgccgtccactgtgaagac
tacgagaaggacgagcacgtcctggtcctgaaacagaccaacttcgacaaagcagttacc
gaacacaagcatgtgctggtcaagttctatgccccctggtgcggccactgcaaggcaatg
gcgccagagtatgtcaaggccgccaagcagctagtggacgaaagctcggacatcaagctc
gccaaggtcgacgccacaatagagactcagctcgccgagacctacgaggtgcgaggctac
ccaaccctcaagttcttccgcgatggcaagccctacgactacaagggtggccgtaccgcc
gacgagatggtgcgttggctcaagaagaggactggacccgcggctgaggacctcaagtcc
gccgatgctgcacgtaccttcgtggatgcctccaaagtgtctgtggttggcttcttcaag
gaccaggcaagcagcgaagccctgcagttcctagaggctgcagaggccatcgacgcccac
ccctttgccatcacgtccgacgacgcggtctacaaggagctgggagcctccaaggatgga
gtcatactcttcaagaagtttgacgagggccgcagcctgatggagggtgctgtgacgtcc
gagagcgtccagtccttcgtcaagaccaacagcctgcctctggtggtagagttcacccac
gagagtgcccagacggtcttcggcggacagatcaagctgcacaacctgctctttgtgagc
aagaagagccccggcttcgaggacattctcaaggactaccgggaggccgccaaggacttc
cgccacaaggtgctcttcgtcaccatcgacgtggacgacgaggaccacgagcgcatcctc
gagttcttcggcctcaagaaggaccaggtgcccgtaatgcgctttgtcaagctggagggc
gagatgaccaagtacaagccggagaaggacgacctcacgcccgagaacgtgcgctcattt
gtgcaagacgtgctggatggcaagctgaagcagagcctcttgtctcaagacctgcccgag
gactgggataggcacgccgtcaaggtcctcgtcaacaagaacttcgatgaggtggtcttt
gacaaggagaaggacgtcctggtcgagttctacgctccctggtgcggacactgcaagcag
ctggccccgatctacgacgagctggctgagaagtacaaggagaagcggccggacctggtg
attgccaagttcgacggcacggccaacgagctggagcacaccaagatgcagggcttcccc
accatccggttgtacaagaagggcaccaacgaggccgtggagtacaacggggagcgcacc
ctcgaggggctgtccaagttcatcgacacggacggggagtatggcaaggcggcccccgag
gaggtcacggaagaggaggaggaagaggaagacaaggaggacaagaagcgcgacgagctc
taa

DBGET integrated database retrieval system