KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW011432Help
Entry
IscW_ISCW011432   CDS       T01131                                 

Definition
single-strand selective monofunctional uracil DNA glycosylase, putative
Orthology
K10800  
single-strand selective monofunctional uracil DNA glycosylase [EC:3.2.2.-]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:isc00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    IscW_ISCW011432
Enzymes [BR:isc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     IscW_ISCW011432
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 256 aa AA seqDB search
MATCSDVASEYLCIERKQCELLLGIPYGDKVSHVYSPVDYARETHECFVRKYCTGAKTVI
FLGMNPGPFGMAQNGVPFGDTEYVRNWLGIEGEVGKPACEHPKRTIVGLNCPRKDVSGQR
FWGLFSELCPSAHAFFGPCFVHNYCPLVFLMPSGANLTPNKLPAQARSAMQAVCDDALVA
VLSLLRPKLVLGVGCYARDRASAVMRKVGDSLGSPTVACLTHPSPASPKANRGWKALALA
ELDSLGVLGCLGGQPP
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgtgctcggacgtggccagcgagtacctgtgcatcgagcggaagcagtgcgag
ctgctcctcggcatcccgtacggggacaaggtgtcgcacgtgtacagcccggtggactat
gcgcgcgagacccacgagtgcttcgtgcgcaagtactgcaccggcgccaagacggtcatc
ttccttggcatgaaccccggaccgttcggcatggcacagaacggggttccctttggagac
acggagtatgtgcgcaattggctcgggatcgaaggtgaagtgggcaagccagcgtgcgag
catcctaagaggaccattgtgggactcaactgccctaggaaagatgtgagcggccagcgt
ttctggggcctcttctcagagctgtgtccaagcgcacatgcgttctttggaccctgcttt
gtgcacaactactgccccctggtgttcctgatgccctcgggggcgaacctgacccccaac
aagctgcccgcccaagcccgctcggccatgcaggcggtgtgtgacgatgccctggtggcg
gtgctgagtcttctgcggccgaagttggtgctcggtgtcggctgctacgccagggaccgg
gcatcggcggtaatgcgcaaggtgggcgactccctgggcagtcccacggtggcctgcctt
acgcacccgagcccagccagtccaaaagccaaccgtgggtggaaggcgctggctctggca
gagctggacagcctgggtgttctcggctgcctcggagggcaacctccgtga

DBGET integrated database retrieval system