KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW011552Help
Entry
IscW_ISCW011552   CDS       T01131                                 

Definition
guanylate kinase, putative (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:isc00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    IscW_ISCW011552
Enzymes [BR:isc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     IscW_ISCW011552
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 224 aa AA seqDB search
MFGLVNQAGGLSTLIHMSALRPLVICGPSGSGKSTLLKKLLKDFGDYFALSVSHTTRKPR
PGEVNGKDYHFISRDEMEQAIEAGEFIEYTEFSGNLYGTSKKSVRDVQDQGRICILDIEI
EGVKNIKNTDLNPRYIFIKPPSMKALEERLRGRGTETEESLRKRLARASEEIAYGENQGN
FDLLLVNDNLKTAYSKLKDYLIKEYSVGLSVIQEVEQLQKKPEI
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgttcggtctcgtcaatcaagcaggcggtctgtccaccttgattcacatgtccgctctg
cgcccgctggtcatctgcgggccatccggaagcggcaagtccacgttgctcaaaaagctg
ctcaaggactttggtgattacttcgccttgagcgtgtcccacaccacgagaaagccgagg
cctggggaggtaaacggcaaagactaccacttcatcagccgcgacgaaatggagcaggcc
atcgaggcgggggagttcatcgagtacacggagttctcgggcaacctctacggcaccagc
aaaaagtctgtgcgcgacgtccaagaccaagggcgcatctgcattctcgacattgagatt
gaaggggtgaagaacatcaaaaacacagatctgaacccccgctacatcttcatcaagcct
ccgagcatgaaggctcttgaagagcgccttcgaggccgggggacagaaactgaggagagc
ctccggaaacgcctggcacgggccagcgaagaaatcgcctacggtgagaaccagggcaac
tttgatctgctcttggtgaatgacaacctcaagactgcctacagcaagcttaaagattac
ctcataaaggaatacagtgtgggtttgtctgttattcaggaagtggaacaacttcagaag
aagcccgagatctag

DBGET integrated database retrieval system