KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW012204Help
Entry
IscW_ISCW012204   CDS       T01131                                 

Definition
sterol reductase, putative (EC:1.3.1.21)
Orthology
K00213  
7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
Steroid biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:isc00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    IscW_ISCW012204
Enzymes [BR:isc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     IscW_ISCW012204
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 403 aa AA seqDB search
MPVSRQYLLVFAERFYRLGFLRFTYNAWTAPGGFTYDLWMWILLLAVYAAAGLLFLPGDV
FHGPTTNSGHTPAYRHTAVPYYILSMGIAGYLLLVRDIPCWPIYRMFPGIAVGITIFGLL
VCALLYVKGTLWPSPGESGSSGSRVFDFYWGLELYPRIGKHLDIKQWSICRVALAVWQFF
VLVSWKAQVEHSGWNWLMAASAILQSSYILKCILAEDWYINGFEFARDRAGHYLVFGSMS
FQGIYYSVTSMYLVEHCPENSALLGLSVIVLGFAMTALNYWADRQKTVARESDGKCIIWG
SPAKILRAKYLDEHGKEKTSLLLASGFWSISRHMNYLFDVLGAFCWALPAGTGSVIPYLL
PLFVTGFMLHRSWRDEDKCSKKYKEYWTEYCSIVKYQLIPFVF
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgccggtaagccgccagtatcttctcgtctttgcggagagattctaccggcttggcttc
cttcggtttacgtacaacgcctggactgctccgggcggcttcacctatgacttgtggatg
tggattctactgttagccgtgtacgccgctgccggactgcttttcttaccgggagacgtc
ttccatggaccgaccacgaacagcggacacacgccggcgtaccgacacacggcagttccc
tactacattctgagcatgggaattgcgggatatctgttgctcgtccgagacattccttgc
tggcccatctaccgcatgtttcccggcatcgccgtgggaattacaattttcgggcttctg
gtttgtgcgctgctctacgtcaagggcacgctgtggccctcccctggcgagtcgggatct
tcgggaagccgcgtgttcgatttttactggggcttagagctctaccctaggattgggaag
cacctggacatcaagcagtggtccatctgccgcgtggcgttggcagtgtggcagttcttt
gtacttgtcagctggaaggcgcaagtggagcacagcgggtggaactggttaatggccgcg
tctgccattttacaatcgtcctatatattaaagtgcatcttggctgaagactggtacatc
aacggcttcgaattcgccagggacagagcaggacactacctcgtgttcggttccatgagc
ttccaaggaatctactactccgtgacaagcatgtaccttgtcgaacactgtcccgaaaac
agcgctcttctcggtctcagcgtgattgtgctaggtttcgcaatgaccgctctcaactac
tgggcagaccgtcagaagaccgtggccagggaatcggacggaaaatgcattatatggggc
tcccctgccaagatcctccgggccaagtacctggacgaacacggcaaggaaaagacgagt
cttctgctggcttctggtttctggtccatcagccgtcacatgaactacctcttcgacgtg
ctcggcgccttctgctgggcactaccggctggaacaggaagcgtgataccttacctgttg
ccgctcttcgtgaccggctttatgttgcaccgaagctggagagacgaggataagtgctcg
aagaagtataaggagtactggaccgaatactgctctatcgtaaaatatcaactgatacct
ttcgtgttttaa

DBGET integrated database retrieval system