KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW012293Help
Entry
IscW_ISCW012293   CDS       T01131                                 

Definition
serine/threonine protein phosphatase PP1, putative (EC:3.1.3.16)
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
mRNA surveillance pathway
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:isc03015]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 293 aa AA seqDB search
MKSRDWTFSHFKMLFEYGGFPPESNYLFLGDYVDRGRHSLETISLLLAYKIKYPENFFIL
RGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPVAAIVDEKIFCMHGGLSPDLQ
SMEQVRRIMRPTDVPDQGLLCDLLWSDPDKDIMGWGENDRGVSFTFGADVVAKFLHKHDL
DLICRAHQAGNQLGGLFLHNPRTEGERVGSGMGERRKRSSSRAPMLPGLGRRKFTCSELK
AVQCLLCVPSWFFLFMGYVLKLLWEQSLCKVGVSGPCLVALAPPSNGQGLSSV
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaagtctcgagactggaccttctctcatttcaaaatgctgttcgagtatgggggcttc
cccccggagagcaactacctgttcctgggggactatgtggatcgtggcaggcattccctg
gagaccatcagcctgctgctggcctacaagatcaagtaccctgagaacttctttatcctg
cggggcaaccatgagtgtgcctccatcaaccgcatctatggcttctacgacgagtgcaag
agaaggtacaacatcaagttgtggaagaccttcacagactgcttcaactgtttacctgtg
gctgccatagttgatgagaaaattttctgcatgcatgggggactgagcccggacctgcag
tcgatggagcaggtgcgccggataatgcgcccgacggacgtgccggaccagggcctgctg
tgcgacctgctctggtctgacccggacaaggacatcatgggctggggcgagaacgaccgt
ggcgtctccttcacttttggggccgacgtggtggccaagttcctccacaagcatgacctc
gacctcatctgcagggcgcatcaggcagggaaccagctcggaggactttttcttcacaac
cccaggacagagggggagagagtgggcagtggcatgggtgagaggaggaagcggagcagc
agcagggcccccatgctgccaggattaggccgaagaaagttcacgtgctcggagctcaaa
gctgtccaatgtcttctctgtgtaccttcctggttcttcctatttatgggttacgtcctc
aagctgctttgggagcaaagtctatgcaaggtgggcgtctccggcccttgcctggttgcc
cttgcccctccgagcaacgggcagggtctgtcgtccgtataa

DBGET integrated database retrieval system