KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW012528Help
Entry
IscW_ISCW012528   CDS       T01131                                 

Definition
histone deacetylase 1, 2,3, putative
Orthology
K11404  
histone deacetylase 3 [EC:3.5.1.98]
Organism
isc  Ixodes scapularis (black-legged tick)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 392 aa AA seqDB search
FLDVAMSKKNVMYFWDPDVGNFHYGPGHPMKPQRLSVTHSLVLHYGLYKKMQASQLSSSN
SHDMCRFHSEEYIDFLERVTPQNIQTFTKSLSHFNVGDDCPVFDGLYDFCSMYTGASLEG
AVKLNNECCDIAINWSGGLHHAKKFEASGFCYVNDIVIAILELLKYHPRVLYIDIDIHHG
DGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYELGAESGRYYSVNVPLKEGIDDASYFQ
VFKPVIQGVMEFFQPSCIVLQCGADSLAGDRLGCFNLSIRGHGECVRFIRELGLPLLVLG
GGGYTVRNVARAWTYETALLVDEPVSSEIPYNEYFEYFAPDFTLHPEVVTRQNANSKQYL
ETIVRAVSENLKCLVHAPSVQMHHVPPDMLPC
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
ttcctagatgtagcaatgtccaagaaaaatgtgatgtatttttgggacccggacgtagga
aatttccactatggtccgggtcacccgatgaagcctcaacgcctctcagtaacccacagc
ttagttctacattatggattatataagaaaatgcaggcaagtcaactttcttcctcaaac
tcgcacgacatgtgccgcttccattccgaggagtatatcgatttcctggagcgagtcact
ccccagaacatccagaccttcaccaagagcctcagtcacttcaacgtcggtgatgactgt
ccagtttttgatggactctacgacttctgttccatgtacacgggggcttccttggaagga
gccgtcaaactcaacaacgagtgctgcgacattgccatcaactggtcgggcggcctgcac
cacgccaagaagttcgaggcgtccgggttctgctacgtcaacgacatcgtcatcgccatc
ttggaactgctcaagtaccacccgcgggtgctgtacatcgacatcgacatccaccacggg
gacggggtgcaggaggccttctacctgacggaccgcgtcatgaccgtgtccttccacaag
tatggcaactacttcttccccggcacgggcgacatgtacgagctgggggccgagagcggc
cgctactactccgtcaatgtgcccctcaaggagggcatcgacgatgccagctacttccag
gtcttcaagccggtgattcaaggggtgatggagttcttccagccgagctgcatcgtgctc
cagtgcggggcggactccctggcgggggaccggctgggctgcttcaacctgagcatccgc
ggccacggggagtgtgtgcgcttcatccgagagctgggcctgcccctgctggtgctgggt
gggggagggtacacggtgcgcaacgtggcgcgcgcctggacctacgagacggccctgctc
gtggacgagcccgtcagctccgagatcccctacaacgagtactttgagtactttgcgccg
gacttcacgctgcacccagaagtggtcacccggcagaacgccaacagcaagcagtacctg
gaaaccattgtgagagccgtttcggagaacctcaagtgtctggtgcacgcccccagcgtc
cagatgcaccatgtgccgccggacatgctgccgtgc

DBGET integrated database retrieval system