KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW012662Help
Entry
IscW_ISCW012662   CDS       T01131                                 

Definition
dfg10 protein, putative (EC:1.3.99.5)
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
isc  Ixodes scapularis (black-legged tick)
Brite
Enzymes [BR:isc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     IscW_ISCW012662
    1.3.1.94  polyprenol reductase
     IscW_ISCW012662
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 171 aa AA seqDB search
MFVCVYSDVRMHIWHYLMGFFFYFGVQLSILSNAPGLSTTVGVMPAFSLAEISWHHIVGT
VIFLWGFCVQFDTHLRMASLRKDPEGKVVSLKHDVPKGGMFEYVSCPHYMAEIVVYSALT
LVLGSPNPTWWLALAWTWVNQVGVAFVSHNWYREQFRNYPRRRKAIFPYLL
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgtttgtctgcgtctactcggacgtcaggatgcacatctggcactacttgatgggattc
ttcttctactttggcgtgcagctctctatcctctccaatgctcccggcttgtcgaccaca
gttggagtgatgccggctttttctctggccgagatctcttggcatcatattgtgggaacg
gtcatctttctttggggcttctgcgtccagtttgacacgcacctccgcatggcgtcgctc
cggaaagatcctgaaggcaaagtggtgtccctcaagcacgacgtcccgaagggcgggatg
ttcgagtatgtgtcgtgcccgcactacatggccgagattgtggtctacagcgccctgacg
ctggtgctgggctcgcccaacccgacctggtggctggcccttgcctggacgtgggtcaac
caggtgggggtggccttcgtcagccacaactggtaccgggaacagttccgcaactatccc
cgccggcggaaggccatcttcccctacctgctttga

DBGET integrated database retrieval system