KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW012689Help
Entry
IscW_ISCW012689   CDS       T01131                                 

Definition
arginase, putative (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:isc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    IscW_ISCW012689
  Amino acid metabolism
   00330 Arginine and proline metabolism
    IscW_ISCW012689
Enzymes [BR:isc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     IscW_ISCW012689
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 369 aa AA seqDB search
MLIVFVLSTSFDSSVSKPRSLNVTHDRQAIVGTSMETRNVEKTKQEIGLVGIPLSCGQEK
LGVEEGPSFLRAAGLVSRLEDLGHTVRDYGDVKVEGNPNVTSANAMKSDCVGQTSKNAKD
AVAEVLSSGLISVNLGGDHTMPIGTVSAHAVAMNSDISLLWVDAHSDINTPLSTTSGHIH
GMPVAFLLHEMEPFLTKPEGMEWIQPCVHKDNFAYIALRAIDPYERYFMDKLGITLYSMD
DVDRIGITEVIRLALRQINPRGTRSLHVSFDIDSIDMLIVPSTGTPVIGGLSMREALVIA
EEVHRSGQLRVLDLAEVNPRLGSAEDANRTVNCGVDLISTFFGRERRGDLPLNLDPTIIE
EMKERDINV
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgctaatcgtttttgttctgagcacgtcttttgattcatcagtaagtaagccgagatca
ctaaatgtgacacatgacagacaagcgattgtcggaacgagcatggaaacacggaatgtt
gaaaagacaaaacaagaaataggcctggttggaattcctctgagctgtggccaggaaaaa
ctcggtgtcgaggaaggcccgtcgtttcttcgagctgcagggcttgtgtcgcgcttagaa
gatctgggtcacacggttcgagactatggcgacgtcaaagttgaaggcaatcccaacgtc
acttcagcaaatgccatgaaaagtgattgtgttggacagactagcaaaaatgcaaaagat
gccgtcgccgaagtcctaagctcaggcttgataagtgtaaaccttggtggtgaccacact
atgcccattggaactgttagtgctcatgcggtagccatgaattctgacatctctcttctc
tgggttgacgcccatagcgacattaatacacctctttctaccacaagtgggcacatacat
ggaatgcctgttgcatttctccttcacgaaatggagccgtttctgacaaagccggaaggt
atggaatggattcaaccctgtgttcacaaggacaattttgcgtacattgccttgagagct
atcgacccttacgaaagatatttcatggataagctcggaattacactttacagtatggat
gacgtcgaccgcattggcatcaccgaagttatacgactcgctctcagacaaatcaacccg
agaggcaccaggtcactacacgtcagtttcgacatagactcaatcgacatgctgattgtt
ccaagcactggaactcccgtaataggcgggctttctatgcgcgaggcgctggtaatagcc
gaagaggtgcacagatccggtcaactccgagttttggatctagctgaagttaaccctagg
ctggggtccgccgaagacgccaaccggaccgtaaactgcggcgtggacctcatatcgact
ttcttcggacgcgaacgaagaggagacctgcctcttaacctggaccccacgattattgaa
gagatgaaggagagagatatcaacgtgtaa

DBGET integrated database retrieval system