KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW012709Help
Entry
IscW_ISCW012709   CDS       T01131                                 

Definition
cell division cycle regulator protein, putative
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:isc00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    IscW_ISCW012709
Protein phosphatases and associated proteins [BR:isc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     IscW_ISCW012709
Ubiquitin system [BR:isc04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     IscW_ISCW012709
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 276 aa AA seqDB search
MATRVALEGLMELLQDLGRAQLYLGQYRVKQAIETLQDLPPHQYSTGWVLAALGRAYFEL
GEYDKAVRVFEELRTLEPYRLKGLEYYSTSLWHLQREVHLSTLAQELMDLDKNAATTCAV
AGNCFSLQREHETAVKFLQRAVQVQHALKKTEMSLTTLNSAMTMEPRNPLCKFHRASIFF
SLDRYQEALKELDELKQMVPKESLVYFLCGKVHKKLGNTHLALMNFSWAMDLDPKGANNQ
IKESIDKRGSPEDEDNDASLLSPSAATPHNLRAELV
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atggccacgcgggtagccctggaggggttgatggagctgctccaggacctggggcgggcc
cagctctacctgggccagtatcgggtcaagcaggccatcgagacgctccaggacctgccc
ccccaccagtacagcacgggctgggtgctggccgcgctgggacgtgcctatttcgagctt
ggcgagtacgacaaggcggtgcgcgtctttgaggagcttcggacgcttgagccctaccgt
ctgaagggcctcgaatactacagcacgtccctgtggcacctgcagagggaggttcatctc
tccacccttgcgcaagagctcatggacttggacaagaacgcagccactacgtgtgcggtg
gcgggcaactgcttcagcctgcagcgggagcacgagacggcggtgaagttcctccagcgg
gcggtgcaggttcagcacgcgctgaagaagacggagatgtccctgacgacgctgaacagt
gccatgacgatggagccccgcaacccgctgtgcaagttccaccgggcgtccatcttcttc
agcctcgaccgctaccaggaggcgctaaaggagctggatgagctcaagcagatggtgccc
aaggagtctctagtctacttcctctgcggaaaggtgcacaagaagctgggcaacacccac
ctggccctgatgaacttctcgtgggccatggacctggaccccaagggtgccaacaaccag
atcaaggagtccatcgacaagcggggtagccccgaagacgaggacaacgacgcctccctg
ctcagccccagtgccgccaccccgcacaacctgcgggcagagctggtctag

DBGET integrated database retrieval system