KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW013308Help
Entry
IscW_ISCW013308   CDS       T01131                                 

Definition
dihydrolipoamide succinyltransferase, putative (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:isc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    IscW_ISCW013308
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    IscW_ISCW013308
   00020 Citrate cycle (TCA cycle)
    IscW_ISCW013308
   00620 Pyruvate metabolism
    IscW_ISCW013308
Enzymes [BR:isc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     IscW_ISCW013308
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 567 aa AA seqDB search
NSPGLPNYRKVLLPALSPTMETGTVISWEKKEGDKLNKGDLLCEIETDKSVMSFESPEEG
YLAKIIVPAGTKDIHLGRVLCILVYSEADIAAFGDFESDRTTVPAGQPKAAASAPASAPA
STQMNYIDIPRTSMRQVMLVLLPALSPTMEMGTIISWEKKEGDKLNEGDLLCEIETDKAT
MGFETPEEGYLAKIIIPAGTKDVPLGKLLCILVYDEADVAAFKDFVDDGTAAPTAQPKAA
AAPAAPAPAPAPTAAPAPAPALTPTTPTPSMAGAPAAGVGGRLFASPLAKRLAAEQGLNL
AQIPVGSGPGGRIVAQDLASAVPMAAAAAPVAAGTKYTDISLTSMRQTIAKRLLQSKQTI
PHYYLSVDINMDAVMKLREEFNKAMEKENIKLSVNDFVIKATALACKKVPQANSSWQETF
IREYKSVDVNMAVSTPEGLITPIVFGAEKKARMLLISEETKSLASKARDKKLQPHEFQGG
TITVSNLGMFGVKNFSAIINPPQACILAVGCTEDVLVPDENSNTGYRAVKMMSVTLSCDH
RVVDGAVGAQWLQHFKRLLERPDLMLL
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
aattcaccaggccttcccaactatcggaaggtcttgcttcctgcgctgtcgccaacgatg
gagacggggacggtcatctcctgggagaagaaagaaggggacaagctgaacaagggtgac
ctcctgtgcgaaattgaaaccgacaagtcagtgatgagcttcgagagccccgaagaaggc
tacctggccaagatcatcgtcccggccggcaccaaggacatacaccttggcagggtcctc
tgcattctcgtctacagtgaggcagacattgctgccttcggagactttgagagcgacaga
actacagttcctgctggtcagcccaaggctgcggcttcggctccggcttcggctccggct
agcacccagatgaattacatagacatccctcggacgagcatgcgccaggtaatgctggtc
ctgcttcctgcattgtccccaacaatggagatggggacgattatctcctgggagaagaag
gaaggggacaagctgaacgagggtgacctcttgtgcgaaatcgaaacagacaaggcaaca
atgggcttcgagacccccgaagagggctaccttgccaaaatcatcatcccggccggcacc
aaagatgtccctcttggcaagctcctctgcattctcgtctacgacgaggcagatgtggct
gccttcaaagactttgtggacgacggcactgcagcacccactgctcagcccaaggctgca
gctgctccggcagcgccggctccggctccagctcccacagcggctccggctccagctccg
gctctgactccgacgacacccactccgtcaatggctggtgctccggccgcgggagtgggg
ggccgcctctttgcgagtcccctcgccaagcggctggcggcagaacaaggcctcaatcta
gcccaaatcccggttggcagtggacccgggggtcgaattgtggctcaggacttggcttcg
gctgtgccgatggccgcggctgcagctccagttgccgctgggacgaagtacacagacatc
tcccttacgagcatgcgacagacgatcgcgaaacgactactccagtcaaagcagacaatt
ccccattactacctctcggtggacatcaacatggacgccgtcatgaagcttcgtgaggag
ttcaacaaggcaatggagaaggagaacatcaagctttcggtgaatgactttgtgatcaag
gccactgccctggcttgcaagaaagtgccgcaggcaaactcctcctggcaggagactttc
atccgagagtacaagtcggtcgatgtcaacatggctgtgagcacacccgaaggtcttatt
accccgattgtatttggagcggagaaaaaggcaaggatgcttctcatcagtgaagagaca
aagagcttggcttcgaaagcacgggacaagaaattacagccacacgagtttcagggtgga
acgataaccgtgtccaacctcgggatgtttggagtcaaaaatttctctgcaatcatcaac
cctcctcaggcttgcatcctggcagtcggctgcacagaagacgtcttggttccagacgaa
aacagcaatacagggtacagggcagtgaagatgatgtcggtgacgttgagctgcgaccac
cgcgtggtggatggggcggtaggagcacagtggctgcagcacttcaagcgtctgctggag
aggccagacctcatgctgctctga

DBGET integrated database retrieval system