KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW013337Help
Entry
IscW_ISCW013337   CDS       T01131                                 

Definition
hypothetical protein
Orthology
K16174  
small subunit ribosomal protein S18b, mitochondrial
Organism
isc  Ixodes scapularis (black-legged tick)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 178 aa AA seqDB search
MERTSDTYLHELKNRASNCCKVEPEATADSEAANGDAEVEETSEPLKHKKVTLHPPETSI
LYLESKAYKDTYGNDPVWTNYRRNFKGQFPPPRTRETCIRAGQIFTGNPCPICRDEYLVV
HHTNVKLLQQFISPYTGEVMKPIKTGLLKYQVPFRHYNYEDYYPQLRRVKKEAEPKSQ
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atggaacgcacgtccgacacctaccttcacgagctcaagaatagggcatcgaactgctgc
aaagtggaaccggaggcgacggcagacagcgaggccgccaacggtgacgcagaggtggag
gaaacatccgagcctttgaagcacaagaaggtcactctgcatccgccggaaacgagcatc
ctctatctggagagcaaagcttacaaggacacatatggcaatgaccctgtctggacaaat
tatcgccgaaacttcaagggacagtttcctcctccaaggacacgggagacttgcatcaga
gctggacaaatctttacggggaacccatgtccaatatgcagggacgaatacctggtggtg
caccatacaaacgtcaagctgctccagcagttcatttctccgtacacgggagaagtcatg
aagccaatcaaaacaggcttgctcaagtaccaagtacccttccgccactacaactatgaa
gattactaccctcagctgagaagagtgaagaaagaagccgagcccaaatcacagtaa

DBGET integrated database retrieval system