KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW013649Help
Entry
IscW_ISCW013649   CDS       T01131                                 

Definition
dehydrogenase kinase, putative (EC:2.7.11.2)
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
isc  Ixodes scapularis (black-legged tick)
Brite
Enzymes [BR:isc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     IscW_ISCW013649
Protein kinases [BR:isc01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   IscW_ISCW013649
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 344 aa AA seqDB search
ENACERTSFVFLRKELPVRLANIMKEIHLLPENLLQMPSVELVKSWYERSFEEILEFENC
HGADEKILSKFCDALIKIRNRHSNVVQTMAQGVIELKETHEPDVRTEHSIQYFLDRFYMS
RISIRMLINQHTSLFGKESGSHHRHIGCIDTNCNVSVIVDDAYENAKFLCDQYYLSSPSV
VVEEYDMLASGKAICVDYVPSHLYHMLFELFKNSMRAVVEYYGTDCESYPPLNVLLCRGK
EDLTIKLSDKGGGIPRSHTELLFQYMYSTAPQPSNSGLNSAPLAGYGYGLPLSRLYARYF
RGDLILTSCEGYGTDAIIYLKALSNEANEMLPVFNKASSKHYSS
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
gaaaatgcgtgcgagaggacgtcctttgtcttcctgcgaaaagaactgccagtgcggcta
gccaacatcatgaaggagatccacctcctgcccgagaacctgctccagatgccttctgtg
gagctggtgaagagctggtatgagagaagttttgaggaaatcttggaatttgaaaactgc
catggagctgatgaaaagatcttatcaaagttctgcgacgccctgatcaaaatccggaac
cgtcactctaacgtagtgcagactatggcgcagggtgtaatcgagttgaaggagacccac
gagcctgatgtcagaacagagcacagcatccagtacttcctggaccgcttctacatgagc
agaatctccatcaggatgctcatcaaccagcacacctccttgttcggcaaagagagtggg
agccaccatcgccacattggctgcatagatactaactgcaatgtctcggtcattgttgat
gatgcctatgaaaacgcgaagtttctatgcgaccagtactacctctcctctcctagtgtc
gtcgtagaagagtatgatatgctggcttctggaaaggcgatttgtgtggactatgtgccg
tcgcatttgtaccatatgcttttcgagttgtttaagaactccatgcgagccgtcgtcgag
tactacggcactgactgcgagagctaccctccgctcaatgtgctgctctgtcgtgggaag
gaagatctcaccatcaagctttcggacaagggtggaggcatcccgaggtcccatacggaa
ctcctgtttcagtacatgtactccacggccccccagccctccaactctggactcaactca
gctccactggctggctatggctatggcctgcccctctcccggctctatgcccgctacttc
cgtggagacctgatcctaacgtcgtgcgagggctacggcaccgacgccattatctacctc
aaggcactgagcaatgaagccaacgagatgctccccgtattcaacaaggcatcgagcaag
cactacagctcg

DBGET integrated database retrieval system