KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW013787Help
Entry
IscW_ISCW013787   CDS       T01131                                 

Definition
phosphatidylcholine-sterol acyltransferase, putative (EC:2.3.1.43)
Orthology
K06129  
lysophospholipase III [EC:3.1.1.5]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
Glycerophospholipid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:isc00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    IscW_ISCW013787
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    IscW_ISCW013787
Enzymes [BR:isc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     IscW_ISCW013787
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 348 aa AA seqDB search
MRFLRGPCQLPTVWVAAVCLLFVAHCADTATIVERLRNTIFPTTNHPIIFVPGDGGSQVQ
AKLNKTYAVHYLCEKKTLDFFDLWVNLELMVPYVLDCWVDNMRLVYNNVTRTTTPPPGVE
IRIPGFGNTSTVEWLDPSMVSPTAYFTKIVEEFVSLGYQRGVNLRGAPYDFRKAPNELGD
YFDKLQGLVEETYEINGAVPVVLVCHSMGCPNLRYFLIESRERTTVTKKPESGGIRSKAG
KESGVASRENLGVVVINPLTVRPEQRSAPSLAYMMPDRLFWNSSEVLVSTLTANYTIADY
YRFFKDIGFLDGYDMYKDTRPYMLDTTPPGVEVHCLHGRNVSTIERYE
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgcggtttttgcgaggaccatgccaactgcccacagtttgggtggccgcggtgtgtttg
ctcttcgttgctcactgcgcggacacggcgaccatcgtagagaggcttcgcaacaccatc
tttcccaccacgaatcatcccatcatattcgtgcccggagatggaggtagtcaagtgcaa
gccaagctgaacaaaacttacgcggtgcactacctctgcgagaagaagacgctggacttc
ttcgacctttgggtcaacttagagctgatggtgccctacgtgctggactgctgggttgac
aacatgaggctggtgtacaacaacgtcacccgcaccaccactcccccaccaggcgtggag
attcggattcctggctttggtaacacgagtactgtcgagtggctcgatccaagtatggtg
tctccgacggcgtacttcactaaaattgtcgaggaatttgtatcccttggatatcaacga
ggcgtcaacctccgtggagccccttacgacttccgcaaagcacccaatgagctcggagac
tacttcgacaagctgcagggactggtggaggagacgtacgaaatcaacggggccgtgccc
gtggtactggtgtgccacagcatgggatgtcccaacctgcgttacttcctcattgaaagt
agagaaagaacgacagtcacaaaaaaaccagaatcaggaggcataagaagtaaagcagga
aaagagagtggagtagcatctcgtgagaatctcggcgtggtcgtcatcaacccgctgacg
gtgcggcccgagcagaggtctgcacccagcctagcctacatgatgcccgaccggctgttc
tggaacagcagcgaagtgctcgtgtccacgctcaccgccaactacacgatcgccgactac
taccgcttcttcaaggacataggattcctggacggctacgacatgtacaaggacactcgg
ccctacatgctcgacaccacgccgccgggcgtcgaggtgcattgtctccacggcagaaac
gtcagcaccatcgagaggtacgag

  All links  
No link information was found.   
DBGET integrated database retrieval system