KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW013988Help
Entry
IscW_ISCW013988   CDS       T01131                                 

Definition
cAMP-dependent protein kinase catalytic subunit, putative (EC:2.7.11.11)
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
Wnt signaling pathway
Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:isc00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    IscW_ISCW013988
   04340 Hedgehog signaling pathway
    IscW_ISCW013988
Enzymes [BR:isc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     IscW_ISCW013988
Protein kinases [BR:isc01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   IscW_ISCW013988
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 265 aa AA seqDB search
MLTMYNNEWEHSGCRRWTHHDATCLYMLFEYVSGGELFTYLRNAGRFSSATGCFYAAEIV
LALEYLHSLHIVYRDLKPENLLLDREGHLKITDFGFAKKLHDRTWTLCGTPEYLAPEIIQ
SKGHNRAVDWWALGVLVYEMLAGYPPYFDDNPFAIYEKILAGKVEWPRHIDPVAKDLIKK
LLVNDRTKRLGSMKNGAEDVKRHRWFKGLNWDDVLEKKLKPPIVPKVSHEGDTGNFDDYP
ERDGRRRPPSTASSSDKEVDTFDDF
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgcttacaatgtacaacaacgaatgggagcactctggttgcaggcggtggacgcaccat
gacgccacctgcctgtacatgctgttcgagtacgtgtccggcggcgagctgttcacgtac
ctgcgcaacgcgggccggttcagctcagccacggggtgcttctacgctgccgagatcgtg
ctggccctcgagtacctgcacagtctgcacatcgtgtaccgggacctcaagccggagaac
ctgctcctggacagggaggggcacctcaagatcacagactttggcttcgccaagaagctg
cacgacaggacgtggacgctgtgcggcactcccgagtaccttgccccggagatcatccag
agcaagggccacaatcgagccgtcgactggtgggcgctcggggtgctcgtctacgagatg
ctcgcagggtatccaccgtacttcgatgacaaccctttcgccatctacgagaagattttg
gcgggaaaagtggaatggccaaggcatatcgatcccgtggccaaggacctcatcaaaaag
ctccttgtcaacgataggaccaagcggctcgggagtatgaagaatggcgccgaagacgtg
aagcgtcaccgttggttcaagggactgaactgggacgacgttctcgaaaagaaactgaag
cccccgatcgtgcccaaggtatcccacgagggtgacaccggcaacttcgacgactacccc
gagcgtgacggccggaggcggccgccctccacagcatcgtcctctgacaaggaggtggac
accttcgacgacttctga

DBGET integrated database retrieval system