KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW014229Help
Entry
IscW_ISCW014229   CDS       T01131                                 

Definition
phosphatidylinositol 3-kinase catalytic subunit, putative (EC:2.7.1.153)
Orthology
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
Inositol phosphate metabolism
FoxO signaling pathway
Phosphatidylinositol signaling system
mTOR signaling pathway
Jak-STAT signaling pathway
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:isc00562]
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:isc04630]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:isc04068]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:isc04070]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:isc04150]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 617 aa AA seqDB search
VDCLMPTGIIIPLDCARDATLESIKDNLWDIAQKYPLFNRLGDPSSYIFVSITRDAEKEE
FYDESRRLCDLHLFHPLLKIIYVRTGIYHGTESLCPFRDTQHVAHSNPKWDEQLEFDMYI
PDIPRSARLCVSICAVYHAQEEGGEPLLRFLSHHFAPDRFRYQSYFMSSDLYLCPFRDTQ
HVAHSNPKWDEQLEFDMYIPDIPRSARLCVSICADPSSWSENDKELVQEIIRRDPLSEIS
EQEKMLLWKMRYYCCSVPDSLPKLLDAHKWNSRDHVAQARNFVFLFSRGFSLYKLLKSWQ
QVSPETALELLDCKYADMFVRKYAVAWLDVSLSDELLSQYLLQLVQERLKFLMEQFSKPD
FLEALQNFPSPLNNSCILGDLIVADCKILDSAKKPLWLLWKNPDHLAEQILDHHEIIFKN
GDDLRQDMLTLQVIRIMDSIWQKEGLDLRMMPYACLSTGKQVGMIEVVRNAKTVMNIQKK
GGRMAAFQVDSTQLHKWIREKNKRERYKQAIETFTLSCAGYCVATFILGIGDRNPDNIMV
NEEGQIFHIDFGHFLGHFKKKFGINRERVPFVLTEDFLHVEKSEEQALEYFQNQFFEAYG
GAWTTKVDWFFHSVKHF
NT seq 1856 nt NT seq  +upstreamnt  +downstreamnt
tcgtggactgtctcatgcccacgggaatcatcatacccctggactgtgccagggatgcta
cgctggaaagcatcaaagataacctttgggacattgcccagaagtacccactgttcaaca
ggcttggggatccttcgtcctacattttcgtgtccatcacacgtgacgcggagaaggaag
agttctacgacgagtctcggaggctctgcgatctccacctcttccaccctttgctgaaga
taatctacgtccgcacgggcatctaccatgggacggagtccctgtgtccctttcgggaca
cccagcacgtggcccactcaaaccccaagtgggacgaacagctggagttcgacatgtaca
ttccggacatcccccgctcggctcggctctgcgtgtccatctgcgcggtctaccatgcgc
aagaagagggaggtgagcccctcctccgcttcctgtcccaccattttgcccctgatcgtt
tccgctaccagtcttatttcatgtcatcggatttgtacctttgtccctttcgggacaccc
agcacgtggcccactcaaaccccaagtgggacgaacagctggagttcgacatgtacattc
cggacatcccccgctcggctcggctctgcgtgtccatctgcgcggaccccagttcctggt
cggagaacgacaaagagctggtgcaggagatcatcagacgggaccccctctccgagatct
cggaacaggagaagatgctgctgtggaagatgcgctactactgctgcagcgtgccagact
cactccccaagctcctagacgcccacaagtggaacagccgcgatcacgttgcacaggcaa
ggaattttgtttttctcttctctaggggattttccctgtacaagctgctcaagtcctggc
agcaggtctccccagagacagcgctggagctgctggactgcaagtatgccgacatgtttg
tacggaagtatgctgtggcctggctggacgtgtccctctcggacgagcttctctcccagt
acctcctgcagctcgtgcaggaacggctgaagttcctgatggagcaattttccaagccag
atttcctggaggcattgcaaaactttccttctccactgaacaacagctgcatcttgggag
acctgatagttgccgactgcaagatccttgactctgccaagaaacccctctggctgctct
ggaaaaaccccgatcacctggcagaacagatactggaccaccacgaaatcattttcaaga
atggagatgatctacggcaagacatgctaacgctgcaagtcatccggataatggacagca
tctggcagaaggaagggctcgatctcaggatgatgccgtatgcctgcctctcgacgggga
agcaggtgggcatgatcgaggtggtgcgcaacgccaagacggtcatgaacatccagaaga
agggaggccgcatggcggccttccaggtggactccacccagctgcacaagtggattaggg
agaagaacaagagggagcggtacaagcaagccattgagacgttcaccctgtcctgtgctg
gctactgcgtcgccacattcatcctgggcataggggacaggaatcctgacaacatcatgg
tcaacgaggaaggacagatctttcacattgacttcgggcacttcctgggccacttcaaga
agaagtttggcatcaaccgtgagcgggtgccctttgtcctgacggaagacttcctccacg
tggagaagtccgaggagcaagccctggagtactttcagaaccagttctttgaggcctacg
gcggagcctggacgacaaaggtggactggttcttccacagtgtcaagcacttctag

DBGET integrated database retrieval system