KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW014481Help
Entry
IscW_ISCW014481   CDS       T01131                                 

Definition
histone deacetylase 4, 5, putative
Orthology
K11406  
histone deacetylase 4/5 [EC:3.5.1.98]
Organism
isc  Ixodes scapularis (black-legged tick)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 900 aa AA seqDB search
GAIASSEVKQRLQEFVLSKKQREAAANSANTSPPNFRNWSRQRSSLDQASPPSTSAVSPQ
CRHPLLGKYDDDFPLRKTASEPNLKVRSVLKQKVIERRSSPLLRRKDKGPVPLKRRPLTS
RHPFLLFLSPHSPSVPSSCNHLLQNLLVLWFFPQEPGNSPYHPLSQGGTNDLTLYSSPSM
PNISLGRPPVPSSSAVSLPLCPAHVFYGLKRAISYVTQDGKILNSVSEAQVRAMAAARLG
MPLTSHVLHSSLPFCSPLPGSPSLGSPIVLPRSALLWWGLTVPPLCFRTIHRPLGRTQSA
PLPLGHPMLQPQGVLINAQLYEQQQQHNLLKQHIRQTVLTRAGSKSQVVEHVEEETEAAV
AQEMKDQPEVIDLTDTRKAPSSENPLDPPTLLLLQRQQQRDLVARHSLHNSSWVVESPTW
VQHAGSAFTPRHPHGHHGARPLSRALSSPLVSLSPPGGSPQTQQQEAATMGNPGAAPGSS
PPRVTTGLAYDSLMLKHQCICGDYSSHPEHGGRLQSIWARLQETGLAARCERIRSRKATL
EEIQSCHDEGYAFMFGTNPLNRQKLEMSKLELPIKSFVMLPCGGIGVDSDTTWNELHTAS
AARMATGCVIELSFKVATGEAKNGFAMVRPPGHHAEFKQAMGFCFFNSVAIAAKQLRQKL
KMEKILVIDWDVHHGNGLQQIFYDDPHVLYVSLHRHDDGNFFPGTGDPQEVGVEDGTGFN
VNIAWSGTLNPPMGDAEYIAAFRTIVMPIARDFDPEIVLVAAGFDAAAGHPPPLGGYQIS
PACFAYMTKQLMTLAKGKVVLALEGGYDLPSICDCSQECVAALLGDEVSPLREEEVTRQP
CGAAVQVLQRTAAIQAPHWPCIKKWAPTIGSSLLDAQQKDKEEVETVTALASLSMAVQMQ
NT seq 2703 nt NT seq  +upstreamnt  +downstreamnt
ggtgccattgcatcatcagaagtaaaacaaaggctgcaggaatttgtgctgagcaagaaa
cagagagaggcagctgccaacagtgcaaacacatcaccaccaaacttcagaaactggtcg
cggcaacggtcatcgttggaccaggcctcaccaccgtcgacgagtgccgtttcgcctcag
tgcagacatccgcttctggggaagtatgacgacgatttccctcttcggaaaacagcgtcg
gaaccgaaccttaaagtgcgctctgtgctgaagcaaaaagtaattgagaggcggagcagc
ccgctcctgcggcgtaaagacaagggtcccgtccccttgaagcggagaccccttacaagt
aggcaccccttcctcctctttctctctccccactctccctctgttccctcgagctgcaac
cacttgcttcaaaacctacttgttttgtggtttttccctcaggaaccgggcaactctccg
taccatccgctctcgcagggcggcaccaacgatctcaccctctactcgtcgccctccatg
cccaacatctcgctcgggcggccgcccgtcccctccagctcggccgtgagtctgccactc
tgccctgcgcacgttttttatggtctcaaaagggcaatctcgtatgttacgcaggacggg
aagatcctcaactctgtgtccgaagcccaagtgcgagccatggctgcggcgaggctgggg
atgccgctcacttctcacgttttacattcgtccctgccgttctgctcacccttgccaggt
agtccttcactcggctcaccaatcgtgttgcctcggagtgcactcttatggtggggcctc
actgtccctcctttgtgtttcagaaccatccaccgacccctgggcaggacccagtcggca
cccctgcccctggggcaccccatgctgcagccccagggggtcctcatcaatgctcagctc
tacgaacagcagcagcaacacaacctgctcaaacagcacatccgccagacggtgctgacg
cgagcgggcagcaagtctcaggtggtggagcacgtagaagaggagacggaggcggccgtg
gcccaggagatgaaggaccagccggaggtcatcgacctcaccgacacccgcaaggctccc
tcctccgagaaccccctcgaccccccaaccctgctcctgctccagcggcagcagcagagg
gacctcgtcgcacgccactccctccacaacagcagctgggtcgtagaatctccaacatgg
gtccaacacgcaggatcggcgttcacgccacgtcacccgcacggccaccacggggcgcgg
ccgctctcgcgcgccctctcgagcccgctggtgagcctgagcccgcccggaggtagcccc
cagacgcagcagcaggaggcggcaaccatgggcaaccccggtgcggcgcccggaagcagc
cctccccgggtgaccacgggcctggcctacgacagcctgatgctcaagcaccagtgcatc
tgcggcgactactcgagccaccccgagcacggcggccggctgcagagcatctgggcgcgg
ctgcaggagacgggactggctgcacgctgcgagagaattcgttcccggaaagcaaccttg
gaggagatccagtcttgccatgatgagggctatgcgtttatgttcggcaccaaccccctc
aaccgacagaagctggaaatgagcaaactggagcttcccatcaagagcttcgtgatgctc
ccctgcggcgggatcggcgtcgactcggacacgacgtggaacgagctgcacacggccagt
gcagcgcgcatggcgaccggttgcgtcatcgagctgtccttcaaagtggccacgggggaa
gccaagaacggtttcgccatggttcgtccccctgggcatcatgccgagttcaagcaagca
atgggcttctgcttcttcaactctgtggcgatagcagccaagcaactgcggcagaagctc
aagatggagaaaatcctcgtcatcgactgggacgtccaccatgggaatggactgcagcag
atcttctacgacgacccccacgttttgtacgtctctctccaccggcacgacgacggaaat
ttcttccccgggacgggagatccccaagaggttggggtcgaagatggaacggggttcaac
gtcaacattgcgtggtctgggacactgaatccaccgatgggagatgcagagtacattgca
gctttcagaaccatcgtgatgccgatcgctcgggatttcgaccctgagattgtgctggtg
gcagctggctttgacgcggctgctggtcacccgcccccgcttggtggctaccagatatca
ccagcatgctttgcctacatgacaaagcaactcatgaccttggcaaaaggaaaagttgtg
ttggcactggaaggagggtatgacctcccctccatctgcgactgctcccaggagtgcgtg
gcggcgctcctcggagatgaagtgagtccgctgagagaagaagaggtcacccggcaaccc
tgtggggcagccgtccaggtgcttcagaggacggcggccattcaagctccacactggcct
tgcatcaagaagtgggcaccgaccatcggctcctcgcttttggacgctcagcagaaggac
aaggaggaggtggagacggtgacagccctggcctcgctttccatggcggtgcagatgcag
taa

DBGET integrated database retrieval system