KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW014656Help
Entry
IscW_ISCW014656   CDS       T01131                                 

Definition
chromatin regulatory protein sir2, putative
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
isc  Ixodes scapularis (black-legged tick)
Brite
Enzymes [BR:isc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     IscW_ISCW014656
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 363 aa AA seqDB search
MSCDYASGLSDYADKGVCGQPEQFDDAALLDDKIARLADWMQSSKHVVVITGAGISTSAG
IPDFRGPNGVWTLEQKGEKPTLNISFDDAVPTPTHMALVALAERAKLQFLVSQNVDGLHL
KSGFPLDTLADLHGNMFVDRCNQCRRQFIRDTATRTVGQKPTGEPCPVPKRNGRLCRGRL
HDSILDWEDELPEDAIEAADAHCRVADLVLCLGSTLQIVPCGTLPLLAKKSAGKIIVCNL
QPTKLDKSANLILRAYVDDVMTKLMAKLGIDIPSYSPGRDPTKGKRELPPVYPRLRLPKV
AKALGSGRRPKQRTKKPQKRASVKDDAKDNLKKLIKAEEPTETSLVLVKESVENDPLLAD
VTG
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtgcgactacgcgagcggtctgtccgactacgccgataagggcgtctgcggccag
cccgagcagttcgacgacgccgcgctactcgatgacaagatcgcgcgcctcgcggactgg
atgcagtcctccaaacacgttgtggtcatcactggcgcgggcatcagcacgtcggctggc
atccccgacttccgaggtccaaacggagtctggaccctcgagcagaagggcgagaaaccc
acactgaacatctctttcgacgacgccgtcccgacccccactcacatggccctagtcgcc
ctcgccgaacgcgccaagctccagttcctggtaagccagaacgtagacggactccacctc
aagtctggcttcccgctggacactctagccgacctgcacggcaacatgttcgtcgaccgc
tgcaaccagtgccgccgacagttcatccgagacacggcgacgcggacggtgggccagaaa
cccacgggcgagccctgtcccgtgcccaagcgcaacggacggctctgcaggggccgcctg
cacgactccatcctagactgggaagacgagctgcccgaagacgccatcgaggctgctgac
gcccattgcagggtcgccgatctcgtcctctgcctgggctcgacgctccagatcgtaccc
tgcggcacgctacccctgcttgcaaaaaagtccgccggcaagatcatcgtgtgtaacctg
cagccgaccaagctggacaagtcggctaacctgatacttcgcgcgtacgtcgacgacgtg
atgacgaagttgatggcgaagttggggatcgacatcccgtcctactcgccgggcagggat
ccgaccaaggggaagcgggagctgccgccggtgtacccgcgcctgcggctgcccaaagtc
gccaaggctctgggcagcggccgccgcccaaagcagcggaccaagaaaccccagaaacgc
gcgtctgtgaaagacgacgcgaaggataacctgaagaagctcatcaaagcggaggagccc
acggagacctcgcttgtgctcgtgaaggaatctgtcgagaacgatcctctacttgccgac
gtgacaggttga

DBGET integrated database retrieval system