KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW014717Help
Entry
IscW_ISCW014717   CDS       T01131                                 

Definition
hyaluronoglucosaminidase, putative (EC:3.2.1.35)
Orthology
K15719  
protein O-GlcNAcase / histone acetyltransferase [EC:3.2.1.169 2.3.1.48]
Organism
isc  Ixodes scapularis (black-legged tick)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 856 aa AA seqDB search
MFYFFLFSFPGFYGRPWTTEQRKDLFQRMKKLGLNTYMYAPKDDFKHRAYWRELYTVEEA
EHLTNLIQAAKENGVHFYYALSPGLDITYSNSKEVSCLKRKLEQVAQFGCSAFALLFDDI
EPEISETDKEVFQSFAHAQVSVTNDVYQELNQPKFIFCPTEYCAARAVPNVQSSEYLNTI
GLKLMPGIDIMWTGHKVISKTITVQSIQELTEVLRRAPVLWDNLHANDYDQKRLFLGPYS
GRSTDLVPHLRGVLSNPNCEYEANFVPIHTLAQWSKCNSDGKRDLSETPFATFWLVANWC
HKHRLTIIYKNVKATCQILWNMARPLGYQLLHGLWCCLRPLAFSSLADESVSADIRLETE
GETEEVPSHMGPHAYHPRKALQAAMADWIPEFYRTKSAYGRLLSGAFLPGAPTGSQQAAL
LDDASFQPLSSELVNSLVQPTLEPMDCNTSPGASPRHVASKSAEEMQTEEAVPAEDSRQL
TLEDVALLVDLFYLPFEHGHQGVAFLQEFHWLRSNGHLVWEGRKRGPPSEEEDAPAMAEL
EEWRKRATKFDLMTQAVGRLFARLTFVPNRSLFYDLYPYIWDIKGVISLLNSYVKWIGFS
KGYKEAFVSGEQEPWLFRGGLTAELQRLLPLESVSDLFLYKPPESPSSKTYTIRPYLPTD
EPLIYEVCRKTCDDGMDGTEVFPEFPNLIGDKLVGGFLTLSNEYCFVVEDETGICGYALA
ALDAQQFNKKLEIAWKPELCLKYPAPAKEPSEMLTPAEEIMSSFHAHPVTVPDVVYKHHP
SRVTMSMLPSILDPSVSKRLLACVLAALKANGSHGVFSEVTVGDKNIVDFYTKLGFLEIA
LPDFLNDEVFFLGRTF
NT seq 2571 nt NT seq  +upstreamnt  +downstreamnt
atgttttatttttttttattttcttttccagggttttatggacgaccatggacgacggag
caacgaaaagatttatttcagagaatgaagaaattgggcctgaacacttacatgtatgcc
ccaaaagatgacttcaagcacagagcttactggagggagctttacactgtagaggaagct
gagcacctaacgaacctcattcaagctgcaaaggaaaatggagtacatttttactatgct
ctctctcctggcctagacatcacttattctaattctaaggaagtctcctgtctgaagcga
aagttggaacaggttgctcagtttggctgtagtgcatttgcgctgctttttgacgacatt
gaacctgagatcagcgagacagataaagaagtctttcagtcgtttgcgcatgcgcaagtt
tcagtaacaaatgatgtctaccaggagttgaatcagccaaaatttatattctgccctaca
gaatactgtgctgctagggcagttccaaatgtccagagttctgagtatttgaatactatt
gggctcaagctaatgcctggcatagacattatgtggacagggcacaaagtgatctccaag
acgataacagtccagtcgattcaagagctgacggaggtgctccggcgtgcccccgtgctc
tgggacaacctgcacgcaaacgactacgaccagaagcggctgttcctggggccgtacagc
ggccggtcgacagacctggttcctcacctgcggggcgtgctctccaaccccaactgcgag
tatgaagccaactttgtgcccatccacacgctggcccagtggagcaagtgcaacagcgac
ggcaagcgagacctcagtgagacgccctttgctactttttggctcgtggcaaactggtgc
cacaaacataggctaaccataatctacaaaaacgtaaaagcgacgtgccaaattctctgg
aacatggctcgacctttgggttaccaacttctgcacggtctgtggtgttgcctcaggcca
ctggcattctcttctctggcagacgagtcggtgagcgccgacatccggctagagacggag
ggggagacagaggaagtgccgtcccacatgggcccccacgcctaccacccacgtaaggcg
ctccaggcagcgatggcggactggattcccgagttctaccgcaccaagagcgcctacggc
cgcctcctgtctggcgcttttctcccgggtgcacccacgggcagccagcaggcggctctg
ctggacgacgccagcttccagcccctctcaagcgagctggtcaactcgctggtgcagccc
acactcgaacccatggactgcaacacgtcgcccggcgcctccccgcgccacgtcgccagc
aaaagtgccgaggagatgcagacggaggaagcggtgcctgccgaggactcgcggcagctc
accctcgaagatgtggcgcttctcgtggacctgttctacctgccctttgagcacggccac
cagggggtggccttcctccaagagtttcactggcttcgctccaacggccacctggtgtgg
gagggccgcaagcggggtccgccgtcggaggaagaggacgcccccgccatggcggagctg
gaggagtggcgcaagcgtgccaccaagttcgacctgatgacgcaggcggtggggcggctc
tttgcccgcctcacgtttgtgcctaaccggtccctcttctatgacctgtacccttacatc
tgggacatcaagggagtcatctcgctgctcaactcctacgttaagtggattgggttctcg
aagggctacaaggaagcttttgtgagtggggagcaagagccatggcttttccgtggtggg
cttacagccgaacttcagcgtcttctcccgctagagagcgtcagcgacctctttttgtac
aagcctccggagtctccaagcagcaagacgtacaccatacggccttacctcccaacggac
gagcctctgatctatgaagtgtgtcgcaagacgtgcgacgatggaatggatgggacggag
gtctttcccgaattccccaacctcattggtgacaaactggttggagggttcctgaccctg
agcaacgagtactgctttgtggtggaggacgagaccgggatctgtggctatgcactggca
gcgctggacgcccagcagttcaacaagaagctggagattgcctggaagcctgaactgtgc
ctcaaatacccggcaccagccaaggagccatcagagatgttgacgccagcagaggagatc
atgagcagcttccacgcgcaccctgtcaccgtgccagatgtggtctacaagcaccaccca
tcgagggtaaccatgagcatgctgccctcgatcctggacccaagtgtctccaagcgcctg
ctggcgtgcgtcctagctgcgctcaaggcaaacggctcgcatggagtgttttctgaagtg
acggtaggagacaagaacatcgttgacttctacacgaaactgggcttcctggaaattgca
ttgccagacttcctgaatgatgaggtcttctttctgggccgaaccttttag

DBGET integrated database retrieval system