KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW014933Help
Entry
IscW_ISCW014933   CDS       T01131                                 

Definition
translation initiation factor 3, subunit B, putative
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:isc00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    IscW_ISCW014933
Translation factors [BR:isc03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    IscW_ISCW014933
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 558 aa AA seqDB search
MEGTSASALCRPWQPASVAARPGLLRPVLRHVLWWGEGGRVPQQQSGARCRQRQRAVDGQ
PGDVVPLGTYLATFHQQGIALWGGPQYNQIMRFTHFGVKFIDFSPCENYLVTLSPPSPDT
FHQPPRGGGGGPGGPEEAQVVIIWDIRTGMKRRSFTADPEMHTWPMFKWSSDDRFFARLT
QDMLSIYETPSFGLLDKKSLKIPGIRNFSWSPVSNILAYWVAEDKNVPARVTLIEVPSRV
ELRAKNLFNVAECKMHWQKSGDYLCVKVDRYTKAKKEKNEWKYSGMYFNFEIFLMKEKQI
PVDSLEIKGVYRSSRFSLSECVSIRSHEASFFFFPYFLDYCLHSVYSLETCFCLYSANMV
PFPKLSTPPHRMSGSLEFVDTSDFTVMNQNDHFMASDVEWDPTGRYVVTGVSWWLHKTDN
AYWLWSFQGRVLRKCNMDRFCQLLWRPRPPSLITEEKLREIRKNFKKYSEQFDLRDRASM
TKASKEVMEKRKKMLEDFRALQERKAKEYMNMRELRMELRDGVDTDELDSNLEDLEEEVV
EFLIKEEEIVTEGDADEE
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atggaaggaacctcagcctcagccctatgtcgaccatggcaacctgcgtcagtggctgca
agacccggactgcttcgaccagttctgcgtcatgtactgtggtggggagaaggtggccgt
gtacctcaacagcaatccggagcccgctgtcgtcaaagacagagagcggtggacggacaa
cctggtgatgtggtccccctgggcacctacctggccaccttccaccagcagggcattgcc
ctctggggcggcccacagtacaaccagatcatgcgcttcacccacttcggggtcaagttc
atagacttctcgccctgcgaaaactacctggtgacgttgagtccaccgtcgccggacacg
ttccaccagccgccgcgaggtgggggcggaggacccggcggtccggaggaggcccaggtg
gtgatcatctgggacatccgcacgggcatgaagagacgcagcttcactgcagacccagag
atgcacacgtggcccatgttcaagtggagcagcgacgaccgcttcttcgcccgcctcact
caggacatgctgagcatctacgaaacgccctccttcggcctgctggacaagaagtccctc
aagatacccggcatcaggaacttctcgtggtccccggtgtcgaacatcctggcctactgg
gtggcagaggacaagaacgtgccggcccgggtgaccctgatcgaggtgccctcccgggtg
gagctgcgggcaaagaacctgttcaacgtggccgagtgcaagatgcactggcagaagtcg
ggcgactacctgtgcgtcaaggtggaccgctacaccaaggccaagaaggagaagaacgaa
tggaagtacagcggcatgtacttcaacttcgagatcttcctcatgaaggagaagcagatc
cccgtggacagcctggagatcaagggtgtgtaccggtcgtcccgtttctccctttccgag
tgtgtttcgatccgcagccatgaagcctctttttttttttttccgtattttttagactat
tgtttgcactctgtatatagcttggaaacttgtttttgcctatatagtgcaaatatggtg
ccgttccccaaactctcgacccctccgcacaggatgagcggctccctggagtttgtggac
acgtcggacttcacggtgatgaaccagaacgaccacttcatggcctcagacgtggagtgg
gacccgacggggcgctacgtggtcacgggcgtctcctggtggctgcacaagacggacaac
gcctattggctgtggtccttccagggccgggtgctgcgcaagtgcaacatggaccgcttc
tgccagctgctctggcggccccggccgccctccctcatcacggaggagaaactgcgcgag
atccgcaagaacttcaagaagtactcggagcagtttgacctcagggaccgtgcctccatg
accaaggcctctaaggaggtgatggagaagcgaaaaaagatgctggaagacttccgagcc
ctgcaagaaaggaaggccaaggagtacatgaacatgcgggagctgcgcatggagcttagg
gacggcgtcgacaccgacgaactggacagcaacctggaggacctggaggaggaggtggtg
gagttcctcatcaaggaggaagagatcgtgaccgagggagatgcagatgaggagtga

DBGET integrated database retrieval system