KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW014936Help
Entry
IscW_ISCW014936   CDS       T01131                                 

Definition
(RefSeq) abhydrolase domain-containing protein, putative
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
isc  Ixodes scapularis (black-legged tick)
Brite
Enzymes [BR:isc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     IscW_ISCW014936
Peptidases [BR:isc01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   IscW_ISCW014936
Exosome [BR:isc04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   IscW_ISCW014936
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
VectorBase: 
UniProt: 
AA seq 463 aa AA seqDB search
MLVAEVRNCWRTTTPAGCKSFMESWLPWVGGVFWRLEGPDGIVLSSLANVCGLYVVNKNH
FLMHRLLLCRHTMLRQRGTATDSTVHEKKGDGSSSSASSAKNSPKPARNQAKTSRLFSRL
LSLLVLAILVIYVIIPGLFYASPWIRRQTVFLTFVNIPPFPNLTSPEYYGLRCGQNLYVQ
SEPSVRLGVWYLPPDSLVRASPEGCGGATEVRDWLARDDRPVVLYLHGNGGSRAGAHRVS
LYKVLSKQLHAHVIAVDYRGYGDSSAVAPTAASIVTDAEAVYRWVREIAPPEKKVLVWGH
SLGTGVSVYLLSRLSKPSATPKVRLPDGVLLEAPFDALHKVAQFHPLSIFHRYLPYFEPV
FVESIRDDAAANFDSVSQVASVAPQTPVMVLHARDDGMVPFALGRNLFDVFEASRKGVKD
AAPVRFAEFEASGGYGHKHIHRNQDLPRIVSGFFTGIFVKKVK
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgttggtggctgaagtccgcaactgttggcggacgacgacgccggcaggttgcaaaagt
tttatggaaagttggctaccctgggtcggaggggttttctggagactagagggccccgat
ggtattgtcctgtctagtttggcgaatgtctgtggtctctacgttgtaaataaaaaccac
tttttgatgcataggctacttctttgcagacacactatgcttcgccagcgtggcactgcc
acggactctaccgtccatgagaagaagggcgacggctcttcttcgtcagcaagctccgcg
aagaactctccgaaaccggcccgcaaccaagccaagaccagccggcttttttcccggcta
cttagcttacttgtcttggctatccttgtcatctatgtcatcatcccgggcctcttctat
gcgtccccatggattcgacggcagacagtgtttctcaccttcgtcaacattcctcctttc
ccgaacctgaccagccccgagtattatggactgcggtgcgggcagaacctgtacgtccaa
tcggagccctccgtccgtctgggggtgtggtacctgccgcccgattcgctcgtgcgcgcg
tcgcccgagggatgcggcggggcaacggaggtgcgtgattggctggcgcgggacgaccgg
cctgttgtgctgtacctccatggcaacgggggttcgagggccggcgcacatcgcgtcagt
ctttacaaagtgctctccaagcagctgcacgcgcacgtgattgccgtggactaccgcggc
tacggcgactcctccgccgtcgcgcccaccgctgcgtccatagtcaccgacgccgaggcc
gtctaccgctgggtgcgcgagatagccccgccggagaagaaggtcctcgtctggggacac
tccttgggcaccggtgtgtccgtctacctcctatcccgcctctctaagccgtctgccacc
cccaaagtccgtctcccggacggtgtccttttagaggcaccctttgacgcactgcacaag
gttgcccagttccaccctctgtctattttccatcggtaccttccatactttgagccggtg
ttcgtggagagcatccgcgacgacgccgctgccaacttcgacagcgtgtcgcaggtggcg
tcggtggcgccgcagacaccggtcatggtgctgcacgccagggacgacggcatggtgccg
tttgcgctcgggcgcaacctgttcgacgtgtttgaggcgtcgcggaagggcgtgaaggac
gccgcgccggtgcggtttgcggagtttgaggcatctggcggctacgggcacaagcacatt
catcggaaccaggatctgccacggatcgtgagcgggttcttcacgggcatctttgtcaag
aaggtcaagtga

DBGET integrated database retrieval system