KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW015100Help
Entry
IscW_ISCW015100   CDS       T01131                                 

Definition
carbonic anhydrase, putative (EC:4.2.1.1)
Orthology
K01672  
carbonic anhydrase [EC:4.2.1.1]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
Nitrogen metabolism
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:isc00910]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 312 aa AA seqDB search
MGSSCSTGTLLPAIVASPGEGQAWGAAVSRWSTAIDRGPQVCEMPTLTVDPDTASRGPSN
WSKIYPKAAGEKQSPIDIVQKNVQSDPFLAENPLRWNYKGLHCTNLLNTGCGWRADVTAQ
GPNISGGPLHHNYQMVQFHSHWGTCSKMGSEHTVDGEHYAGELHLVHYNLDMYSRASEAA
CSDKGLSVIGIFLKEGQPHEELQKITDSMKKVIYRGDKCSIDQDIDIGSLIPKNSSYWTY
EGSLTTPPCYESVTWIVFKEPIEVSQEQFEAFRELMSYKEGEGPKAPTDGPILKNYRPPQ
PLMGRVVRDPAN
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgggttcgtcgtgctcgaccggaaccttgctgccggccatcgtcgcatccccaggcgag
gggcaagcctggggggcagcggtgtcgcgttggtccacggcgatcgaccggggaccccag
gtttgcgagatgcctacgctgacggtggacccagacactgcgagccgaggtccatcgaac
tggtcgaagatctaccccaaggccgcgggagaaaagcagtcacccatcgacattgtgcag
aagaatgtgcagtccgacccgttcctggcagagaacccactccgatggaactacaagggc
ctgcattgcacgaacttgctcaacactggctgtggctggagggccgacgtgaccgctcag
ggcccgaatatttctggggggcctctacaccacaactatcagatggtccagttccacagc
cactggggcacctgcagcaagatgggaagcgagcacaccgtcgacggggaacactatgca
ggcgagttgcaccttgtccactacaacctggacatgtattccagagcttcagaagcagcg
tgctccgataagggactgagtgttatcggcatctttcttaaggaaggacagcctcatgaa
gagttgcagaagatcacggatagcatgaaaaaggttatctacagaggcgacaagtgttcc
atagatcaagacattgacattggctcactcattcctaaaaacagttcttattggacatat
gagggctcactgaccactcctccctgctatgaaagtgtcacctggattgtgttcaaggag
cccattgaagtgtcacaagagcagttcgaggcattccgggaactgatgtcgtacaaggag
ggggaaggccccaaggcaccgacagacggccccatactcaaaaactatcggccaccccaa
cctctgatgggccgggttgtgcgggatcccgccaactga

DBGET integrated database retrieval system