KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW015586Help
Entry
IscW_ISCW015586   CDS       T01131                                 

Definition
USP16, putative (EC:1.3.1.74)
Orthology
K11844  
ubiquitin carboxyl-terminal hydrolase 16/45 [EC:3.1.2.15]
Organism
isc  Ixodes scapularis (black-legged tick)
Brite
Enzymes [BR:isc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     IscW_ISCW015586
Peptidases [BR:isc01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   IscW_ISCW015586
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 635 aa AA seqDB search
MARKKKKHQEDPTEDVPDSSGEGPDVPDDGSAAGNAAACVHGRGSVNLRRVRQLLQRSPL
RLDECDDCQDAGPDDIWVCLQCGHRGCGTKWPGRHAVCHAERTYSDSHALALSSQSMELW
CYKCDRTVEASSQVVQIVGAIRKKLTTGTKKSPQSTSARNSSSSSTEEPRAVENDRPTEV
SRVEVAVGTKDEPTLASKPELTTVAGKWVTVKGLSNLGNTCYFNAVMQCLSQTPALDELL
AKRCSNDLHCTFEPSIAPAAEGDPGPLEVKLPGPGFLTSALALFLREMRQGVPRPGQLFS
RLCQAAPQFRGHHQHDSHELLRHLLEGVRSEEVKRHMQAVLNAFGLSSKVNPRQVGTDTK
AKVQAYKKAVSRVALDDIFGGLLLSTLICQQCGQVSRREDPFQDLSLPIPEDKAPRNVHA
GHGKRAKGKLGGRVATGRAGALSGGGAADPTEADEEDNVSPDLASQVEVLHLEEAPGGVK
EPPEGSLDACLRSFTAPELLAGANGLHCEGCGVARAAASLQLQVLQPPRVLTLHLKRFQQ
GSSLRKVQRHVAFPVELDLGPYCSGQAEGCKSYTLYGVVEHSGRMTGGHYVAYVRGAGGG
WFYASDGRVAPAPQRKVLASQAYLLFYGRTDTLCQ
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atggcaaggaaaaagaaaaagcaccaagaggatcccaccgaagatgtgcccgactcgtcc
ggtgagggtccagacgtccccgacgatgggagcgccgcagggaatgccgcagcttgcgtc
catggccgggggtcggtcaacctgcgacgtgtgcggcagttgctccagcgatctcctctg
cgactcgacgagtgcgacgactgccaagacgcgggccccgacgacatctgggtgtgcctg
cagtgcggtcaccggggatgcggtaccaagtggcccggacggcatgctgtatgccacgcc
gagaggacgtactcggactcgcacgcgctcgcactctcctctcagtccatggaactctgg
tgctacaagtgcgaccggacggtggaggccagttcgcaggtggtgcagatcgttggtgcc
atacggaagaagttgacgaccggcacaaagaagtctccacagtcaacatctgctcggaac
agttcctccagctccactgaggagcctcgggcagttgaaaatgaccggccaacagaggtc
tccagggttgaggtggccgttgggaccaaggacgaaccgactctggcgtccaagccggag
ctgacgactgttgctggcaagtgggtgactgtcaagggtctcagcaacctgggcaacacg
tgctactttaatgcggtgatgcagtgtctgtcccagactcctgctctagacgaactgctt
gccaagcggtgcagtaacgatctgcactgcaccttcgagccttccattgctccagcagcc
gaaggagatcccggccccctggaagtcaaactcccggggccaggattcctgacaagtgcc
ttggccttgtttctgcgggagatgaggcagggcgtgcctcggcccgggcagctcttctct
cggctgtgccaggcggccccacagtttcgagggcaccaccagcacgacagccacgagtta
ctgcgccacctgctggaaggcgtcaggtcggaggaggtcaagcgtcacatgcaggctgtc
ctgaatgcctttgggctcagctccaaggtgaaccccagacaggtgggaacagacaccaag
gccaaagtgcaagcttacaaaaaggccgtctcccgtgtcgcactggatgacatatttggt
ggcctgctgctcagcacccttatctgtcagcaatgtgggcaggtctcccggcgagaggac
cccttccaagacctctccctgcccatcccggaggacaaggctccccggaacgtacatgcc
ggccacggcaagcgggccaagggcaagctgggaggcagggtcgcgacgggcagggctggg
gctctgagcgggggaggggcggccgacccgaccgaggcagacgaggaggacaacgtcagc
ccggacctggcgtcgcaggtggaggtgctgcacctggaggaggcacctgggggcgtcaag
gaacctcccgagggatccctggacgcctgcctgcgcagcttcacggcacccgagctgctg
gcgggtgccaacggtctgcactgcgaaggctgcggcgtcgctcgtgcggcggccagcctg
caactgcaggtgctccaaccaccgagggtgttgacgctgcacctcaaacgcttccagcag
ggatcatccctgcgtaaggtgcagcgccacgtggccttccccgtcgagctggacctgggg
ccctactgcagtggccaggctgagggctgcaagagctacacgctttacggagttgtggag
cactcgggacgcatgaccggaggtcactacgtggcctacgttcggggtgccggcggagga
tggttctacgccagcgacggccgggtggcgccggctccccagcggaaggtgctggccagc
caggcctacctcctcttctacggtcgcacggacacgttgtgtcaataa

DBGET integrated database retrieval system