KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW015611Help
Entry
IscW_ISCW015611   CDS       T01131                                 

Definition
phosphoribosylamidoimidazole-succinocarboxamide synthase, putative (EC:4.1.1.21 6.3.2.6)
Orthology
K01587  
phosphoribosylaminoimidazole carboxylase / phosphoribosylaminoimidazole-succinocarboxamide synthase [EC:4.1.1.21 6.3.2.6]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
Purine metabolism
Metabolic pathways
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:isc00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    IscW_ISCW015611
Enzymes [BR:isc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.21  phosphoribosylaminoimidazole carboxylase
     IscW_ISCW015611
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.6  phosphoribosylaminoimidazolesuccinocarboxamide synthase
     IscW_ISCW015611
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 354 aa AA seqDB search
IKTHFVRKHDDKSFVARNCAMVPIEWVSRRVATGSFLKRNPGVNEGFRFCPPKLETFFKD
DANHDPQWSTEQLVDAKLKCGNTVIGPEEVQVMLRTSRTVFEILEKAWASLNCSLIDMKV
EYGVDLQTGELLLADIIDSDSWRLWPSGDKRLMVDKQVYRNLKEVTDQDLETVKKNFAWM
FPPFVQKLNPKPKSQVAVVMGSPSDKEHCEKIKKACEKLGVPCELRVASAHKNTDQSLDL
IAEYEGEGIPTVFVSVAGRSNGLGPVTSGNSAFPVINCPPLSGEWGPHDIWSSLRVPSGL
GCTTVLFPEAAALAAAQILGLSDHVIWAKLRASQLNTWVALKMADKKIRAEQKS
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atcaagacgcactttgtgcgcaagcacgatgacaagtccttcgtggcccgtaactgtgcc
atggtgcccatcgagtgggtgtccaggagggtggccaccggctccttcctcaagaggaac
cccggggtcaacgaaggcttccgcttctgcccgcccaagctggagactttcttcaaggac
gacgccaaccacgacccccagtggtccacggagcagctcgtggacgcaaagctcaagtgc
ggcaataccgtcatcggtcccgaggaggtgcaggtgatgctgcgcactagccgcaccgtg
ttcgagatcctcgagaaggcctgggcctccctcaactgcagcctcatcgacatgaaggtg
gagtacggagtggatctccagacaggtgagctgctgttggcagacatcattgacagcgac
tcgtggcgcctgtggccctctggcgacaagaggctcatggtggacaagcaggtgtaccgc
aacctcaaggaggtcaccgaccaggatctagagaccgtcaagaagaactttgcttggatg
tttcctccctttgtacagaaactgaaccccaagcccaagtctcaggtggcagttgtgatg
gggtctccctcggacaaagagcactgcgagaagatcaagaaggcctgcgagaagctggga
gtcccctgcgagctcagggtggcctccgcacacaagaacaccgaccagtcgctggacctg
atcgccgagtacgaaggtgaaggcattccgaccgtgtttgtcagtgtggccggtaggagc
aacggcttgggtcccgtgacttcgggcaactctgccttcccagtcatcaactgccctccg
ctgtctggagagtggggacctcacgacatctggtcttcgcttcgcgtgccttccgggctg
ggctgcaccaccgtgcttttcccggaggctgctgcactggctgcagcccaaatcttgggc
ctgagcgaccatgtcatctgggcaaagctgcgggcatcccagctgaacacttgggtggca
ctcaagatggccgacaagaaaatcagggccgagcagaagtcttga

DBGET integrated database retrieval system