KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW015728Help
Entry
IscW_ISCW015728   CDS       T01131                                 

Definition
lysophospholipase, putative (EC:3.1.1.1)
Orthology
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:isc00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 227 aa AA seqDB search
LCMGGNSVSTMPSPVVISATAKHTATVIFMHGLGDTGCGWSSMFEAIRMPHVKYVCPTAP
TIPVTLNGGMRMPAWFDLLSLDPNGMEDENGIKTAAEGIHRLIAEEEKAGIPTERILIGG
FSMGGALALYSGLRYPKTLGGILGLSCWLPLFKHFPSAAIGNKDTPVLLCHGESDDLVPL
RWGSLTSNLLKTFVKDVQFKQYRGLGHSSCDEVHSFIFFLSPSLPTF
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
ctgtgtatgggaggaaattccgtgtccaccatgccttctccagtcgtgatctcggcgacc
gccaaacacactgccaccgtcatcttcatgcatggcttgggtgacacagggtgtggctgg
tcatccatgttcgaagccataaggatgccccacgtcaaatacgtctgtcccacagcgcca
acaattccagtcacgctcaacggaggcatgcggatgcctgcgtggttcgatctcctgtcc
ctcgacccaaacgggatggaagacgagaacggaatcaagactgcggcagaagggattcat
agactcattgcggaggaagagaaggcgggcatccccacagagcgcatcctcatcggcggc
ttcagcatggggggtgccctggccctgtactccggcctgcgctaccccaagaccctcgga
ggcatcctcggcctcagctgttggctacccctgttcaagcactttccaagcgcggccatt
ggcaacaaggacacgcccgtgctcctctgccacggagagagcgacgacctggtgccccta
aggtggggttctttgacctcgaacctcctcaagacctttgtcaaggacgtgcagttcaag
cagtacaggggactgggacattcctcgtgcgacgaggtacattcttttattttttttctc
tcccccagcctccccactttc

DBGET integrated database retrieval system